BT10077

Link to gene wiki page

[-] General Information


Transcripts for BT10077 BT10077-RA  

NCBI Gene Symbol: GYS2

Description:
glycogen synthase 2 (liver)

Overlapping Locus Information:

NCBI: 537451

Genomic Location: Chr5.89   1246258 .. 1302381    [+]

[-] Transcripts for BT10077

BT10077-RA

Gene Model Source: RefSeq 
OGSv1 ID: GLEAN_20925 

Sequences:

Transcript: BT10077-RA View Text HTML XML
Protein: BT10077-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: XM_617616.3
NCBI Protein: XP_617616.3
Ensembl Transcript: ENSBTAT00000017728
Ensembl Protein: ENSBTAP00000017728

User Submitted Information:

Submitter Name: Seongwon Seo
Submitter ID: swseo
Temporary ID: Btgn_tempid_260-PA

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT10077-RA
ATGCTTCGAGGTCGATCGCTATCTGTGACATCCCTAGGTGGGCTGCCTCG
GTGGGAAGCCGGACTTCCTGTGGAGAATTTACTGCTCTTTGAAGTCTCTT
GGGAAGTGACCAATAAAGTCGGTGGCATCTATACTGTGATTCAGACAAAG
GCCAAAACAACAGCAGATGAATGGGGAGACAACTATTTTCTGATTGGTCC
ATATTTTGAGCATAATATGAAGACTCAGGTGGAACAGTGTGAACCTGTGA
ATGATGCTGTTAGAAGAGCCATGGACACGATGAACAAACACGGCTGCCAG
GTGCGCTTTGGAAGATGGCTGATAGAAGGGAGTCCTTACGTGGTTCTCTT
TGACATTGGCTATTCGGCTTGGAACCTGGACAAGTGGAAAGGAGACCTCT
GGGAAGCATGCAGCGTTGGCATTCCTTATCACGACCAGGAAGCCAATGAT
ATGCTGATCTTTGGGTCATTAACTGCCTGGTTCTTGAAAGAGGTGACGGA
CCATGCTGATGGGAGACATGTCATTGTCCAGTTCCATGAATGGCAAGCTG
GGATTGGACTGATCCTTTCTCGAGCTCGGAAACTGCCCATTGCTACAGTC
TTTACCACCCACGCCACACTGCTTGGGCGGTATCTTTGTGCAGCTAACAT
CGATTTCTACAACCACCTTGATAAGTTTAACATAGACAAAGAGGCTGGGG
AAAGGCAGATTTATCACCGGTATTGCATGGAGCGCGCTTCCGTCCATTGT
GCTCATGTTTTCACCACAGTTTCTGAAATTACCGCAATAGAGGCAGAACA
CATGCTGAAGAGAAAACCTGATGTAGTTACTCCAAATGGCTTGAACGTTA
AGAAATTTTCAGCTGTACATGAGTTTCAAAATCTCCATGCTATGTACAAG
GCCAGAATCCAAGAGTTTGTTCGAGGTCATTTCTATGGTCATCTGGACTT
TGATCTTGAAAAAACGTTATTCCTCTTCATTGCTGGGAGGTATGAGTTTT
CAAACAAAGGAGCTGACATCTTCTTAGAATCCTTATCCAGGTTAAACTTC
CTGCTGAGGATGCATAAAAGTGATGTCACCGTGGTGGTGTTTTTCATTAT
GCCTGCCAAGACAAACAATTTCAATGTGGAAACCCTGAAAGGCCAGGCAG
TGCGCAAACAGCTATGGGACACTGCACATTCTGTGAAGGAAAAGTTTGGA
AAGAAACTGTATGATGCATTATTAAGAGGAGAAATTCCTGACATGAACAA
TATTTTGGACCGAGATGATATGACAATTATGAAAAGAGCTATCTTTTCAA
CTCAGCGGCAGTCTTTGCCCCCAGTGACTACTCACAACATGATTGATGAT
TCCACCGATCCCATCCTCAGCACCATTAGACGTATCGGGCTCTTCAATAG
CCGCACAGACAGAGTCAAGTTGATTTTGCACCCAGAGTTCCTGTCCTCCA
CCAGCCCCTTGCTACCCATGGATTATGAAGAGTTTGTCCGAGGTTGTCAT
CTTGGAGTATTTCCATCTTACTATGAACCCTGGGGTTATACTCCAGCTGA
ATGCACTGTGATGGGCATCCCCAGTGTGACCACCAATCTCTCTGGCTTTG
GCTGTTTCATGCAGGAACATGTGGCTGACCCCACTGCATACGGAATTTAC
ATCGTTGACAGGCGGTTCTGCTCACCCGATGATTCTTGCAATCAGCTGAC
TCAGTTTCTCTATGGATTTTGCAAACAGTCACGCCGCCAGAGGATTATTC
AAAGGAATCGAACCGAGAGGCTCTCAGATCTTCTGGACTGGAGATACTTA
GGCAGATATTACCAGCATGCCAGGCACCTGACATTAAGCAGAGCCTTTCC
AGAAAAATTCCACATGGAACCCACATCACCACCAACGACAGAAGGGTTTA
AGTATCCCAGGCCGCCCTCGGTACCACCTTCTCCGTCGGGATCTCAGGGC
TCCAGTCCTCAGAGCAGCGATGCGGAGGATGACGATGAGGATGAGAGATA
CGACGAGGAGGAAGAGGCCGAAAGGGATCGGTTAAATATCAAGTCTCCGT
TTTCTCTGAGTCACGTTTCTCGCGGGAAGAAGAAGCAGCACGGAGAATAC
AAGAAT



Protein Sequences

>BT10077-PA
MLRGRSLSVTSLGGLPRWEAGLPVENLLLFEVSWEVTNKVGGIYTVIQTK
AKTTADEWGDNYFLIGPYFEHNMKTQVEQCEPVNDAVRRAMDTMNKHGCQ
VRFGRWLIEGSPYVVLFDIGYSAWNLDKWKGDLWEACSVGIPYHDQEAND
MLIFGSLTAWFLKEVTDHADGRHVIVQFHEWQAGIGLILSRARKLPIATV
FTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYHRYCMERASVHC
AHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMYK
ARIQEFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNF
LLRMHKSDVTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHSVKEKFG
KKLYDALLRGEIPDMNNILDRDDMTIMKRAIFSTQRQSLPPVTTHNMIDD
STDPILSTIRRIGLFNSRTDRVKLILHPEFLSSTSPLLPMDYEEFVRGCH
LGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEHVADPTAYGIY
IVDRRFCSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRYL
GRYYQHARHLTLSRAFPEKFHMEPTSPPTTEGFKYPRPPSVPPSPSGSQG
SSPQSSDAEDDDEDERYDEEEEAERDRLNIKSPFSLSHVSRGKKKQHGEY
KN




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.