BT10309

Link to gene wiki page

[-] General Information


Transcripts for BT10309 BT10309-RA   BT10309-RB  

NCBI Gene Symbol: NEU1

Description:
sialidase 1 (lysosomal sialidase)

Overlapping Locus Information:

NCBI: 505554
Ensembl: ENSBTAG00000005674

Genomic Location: Chr23.26   275690 .. 279043    [+]

GO Annotations for BT10309

Biological Process
GO:0008152 IEA  metabolic process
Molecular Function
GO:0004308 IEA  exo-alpha-sialidase activity
GO:0005515 IEA  protein binding
GO:0016798 IEA  hydrolase activity, acting on glycosyl bonds
Cellular Component
GO:0005886 IEA  plasma membrane
GO:0016023 IEA  cytoplasmic membrane-bounded vesicle
GO:0043202 IEA  lysosomal lumen

[-] Transcripts for BT10309

BT10309-RA

Gene Model Source: Manual 
OGSv1 ID: GLEAN_00725 

Sequences:

Transcript: BT10309-RA View Text HTML XML
Protein: BT10309-PA View Text HTML XML

User Submitted Information:

Submitter Name: Hari Nandakumar
Submitter ID: groupleader
Temporary ID: Btgn_tempid_2247-PA

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

BT10309-RB

Gene Model Source: GLEAN 

Sequences:

Transcript: BT10309-RB View Text HTML XML
Protein: BT10309-PB View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_001083642.1
NCBI Protein: NP_001077111.1
Ensembl Transcript: ENSBTAT00000007454
Ensembl Protein: ENSBTAP00000007454

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT10309-RA
ATGCTGCGATTATGGGGAATCTGTAGGGTTCAGATATTTTCTGCGATCTT
CATGCTAATGTCTCCTGCAGGAGTCGGGGCCGGAGCAAAGGATGACTTCA
GTCTGGTTCATCCACTTGTGACCATGGAACAACTTCTGTGGGTGAGTGGG
AAGCAAATCGGCTCCGTGGACACTTTCCGAATCCCGCTCATCACCACCAC
TCCTCGGGGCACTCTCCTTGCCTTTGCTGAGGCCAGAAAAATGTCGACAT
CGGATAAAGGAGCTAAATTCATAGCTCTGCGGAGGTCTATGGACCAGGGC
AGCACATGGTCTCCGACAGCTTTCATTGTGGATGATGGGGAGACCCCAGA
TGGGCTGAACTTGGGGGCAGTGGTGAGCGACACGACGACAGGCGTGGTCT
TCCTTTTCTACTCCCTCTGTGCTCATAAGGCTGGCTGCCAGGTGGCCTCT
ACCATGCTGGTGTGGAGTAAGGATGATGGTGTTTCCTGGAGCTCGCCGCG
GAACCTCTCCCTGGATATAGGCACCGAGATGTTTGCCCCAGGACCGGGCT
CTGGCATTCAGAAACAGCGGGAGCCTCGGAAGGGCCGACTTATCGTGTGT
GGCCACGGAACGCTGGAGCGGGATGGGGTTTTCTGCCTGCTCAGCGATGA
TCATGGCGTCTCCTGGCGCTACGGAGGTGGGGTCAGTGGCATCCCCTACG
GCCAGCCCAAGCGGGAAAATGACTTCAACCCCGATGAGTGCCAGCCCTAC
GAGCTCCCCGATGGCTCAGTCGTCATCAACGCGCGGAACCAAAACAACTA
CCACTGCCATTGCCGCATCATCCTCCGCAGCTACGACGCCTGTGACACCC
TGAGGCCTCGGGATGTGACCTTTGACACGGAGCTCGTGGACCCTGTGGTA
GCTGCAGGGGCTGTAGCCACCAGCTCTGGCATTGTCTTCTTCTCCAACCC
AGCCCATCCAGAGTTCCGAGTAAACCTGACCCTGCGCTGGAGCTTCAGCA
ATGGTACCTCCTGGAGGAAGGAGACGGTCCAGCTGTGGCCGGGGCCCAGT
GGCTATTCATCGCTGACCACCCTGGAGGGCAACGTGGATGGGAAGGATGA
GGCCCCACAGCTCTACGTCCTGTATGAGAAAGGCCGGAACCAGTACATGG
AGAGCATCTCTCTGGTCAAAGTCAGCGTCTACGGAACACTG


>BT10309-RB
ATGACTGAAGAGGGACCCGGTATAGTGTCCTTGGGCAAACTCAGGAGACC
GCGAATGCTGCGATTATGGGGAATCTGTAGGGTTCAGATATTTTCTGCGA
TCTTCATGCTAATGTCTCCTGCAGGAGTCGGGGCCGGAGCAAAGGATGAC
TTCAGTCTGGTTCATCCACTTGTGACCATGGAACAACTTCTGTGGGTGAG
TGGGAAGCAAATCGGCTCCGTGGACACTTTCCGAATCCCGCTCATCACCA
CCACTCCTCGGGGCACTCTCCTTGCCTTTGCTGAGGCCAGAAAAATGTCG
ACATCGGATAAAGGAGCTAAATTCATAGCTCTGCGGAGGTCTATGGACCA
GGGCAGCACATGGTCTCCGACAGCTTTCATTGTGGATGATGGGGAGACCC
CAGATGGGCTGAACTTGGGGGCAGTGGTGAGCGACACGACGACAGGCGTG
GTCTTCCTTTTCTACTCCCTCTGTGCTCATAAGGCTGGCTGCCAGGTGGC
CTCTACCATGCTGGTGTGGAGTAAGGATGATGGTGTTTCCTGGAGCTCGC
CGCGGAACCTCTCCCTGGATATAGGCACCGAGATGTTTGCCCCAGGACCG
GGCTCTGGCATTCAGAAACAGCGGGAGCCTCGGAAGGGCCGACTTATCGT
GTGTGGCCACGGAACGCTGGAGCGGGATGGGGTTTTCTGCCTGCTCAGCG
ATGATCATGGCGTCTCCTGGCGCTACGGAGGTGGGGTCAGTGGCATCCCC
TACGGCCAGCCCAAGCGGGAAAATGACTTCAACCCCGATGAGTGCCAGCC
CTACGAGCTCCCCGATGGCTCAGTCGTCATCAACGCGCGGAACCAAAACA
ACTACCACTGCCATTGCCGCATCATCCTCCGCAGCTACGACGCCTGTGAC
ACCCTGAGGCCTCGGGATGTGACCTTTGACACGGAGCTCGTGGACCCTGT
GGTAGCTGCAGGGGCTGTAGCCACCAGCTCTGGCATTGTCTTCTTCTCCA
ACCCAGCCCATCCAGAGTTCCGAGTAAACCTGACCCTGCGCTGGAGCTTC
AGCAATGGTACCTCCTGGAGGAAGGAGACGGTCCAGCTGTGGCCGGGGCC
CAGTGGCTATTCATCGCTGACCACCCTGGAGGGCAACGTGGATGGGAAGG
ATGAGGCCCCACAGCTCTACGTCCTGTATGAGAAAGGCCGGAACCAGTAC
ATGGAGAGCATCTCTCTGGTCAAAGTCAGCGTCTACGGAACACTG



Protein Sequences

>BT10309-PA
MLRLWGICRVQIFSAIFMLMSPAGVGAGAKDDFSLVHPLVTMEQLLWVSG
KQIGSVDTFRIPLITTTPRGTLLAFAEARKMSTSDKGAKFIALRRSMDQG
STWSPTAFIVDDGETPDGLNLGAVVSDTTTGVVFLFYSLCAHKAGCQVAS
TMLVWSKDDGVSWSSPRNLSLDIGTEMFAPGPGSGIQKQREPRKGRLIVC
GHGTLERDGVFCLLSDDHGVSWRYGGGVSGIPYGQPKRENDFNPDECQPY
ELPDGSVVINARNQNNYHCHCRIILRSYDACDTLRPRDVTFDTELVDPVV
AAGAVATSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPS
GYSSLTTLEGNVDGKDEAPQLYVLYEKGRNQYMESISLVKVSVYGTL


>BT10309-PB
MTEEGPGIVSLGKLRRPRMLRLWGICRVQIFSAIFMLMSPAGVGAGAKDD
FSLVHPLVTMEQLLWVSGKQIGSVDTFRIPLITTTPRGTLLAFAEARKMS
TSDKGAKFIALRRSMDQGSTWSPTAFIVDDGETPDGLNLGAVVSDTTTGV
VFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSSPRNLSLDIGTEMFAPGP
GSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGVSWRYGGGVSGIP
YGQPKRENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIILRSYDACD
TLRPRDVTFDTELVDPVVAAGAVATSSGIVFFSNPAHPEFRVNLTLRWSF
SNGTSWRKETVQLWPGPSGYSSLTTLEGNVDGKDEAPQLYVLYEKGRNQY
MESISLVKVSVYGTL




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.