BT10494

Link to gene wiki page

[-] General Information


Transcripts for BT10494 BT10494-RA  

NCBI Gene Symbol: COL1A1

Description:
collagen, type I, alpha 1

Overlapping Locus Information:

NCBI: 282187
Ensembl: ENSBTAG00000013103

Genomic Location: Chr19.23   914359 .. 930769    [+]

GO Annotations for BT10494

Biological Process
GO:0001568 IEA  blood vessel development
GO:0001649 IEA  osteoblast differentiation
GO:0001957 IEA  intramembranous ossification
GO:0001958 IEA  endochondral ossification
GO:0007601 IEA  visual perception
GO:0007605 IEA  sensory perception of sound
GO:0010812 IEA  negative regulation of cell-substrate adhesion
GO:0015031 IEA  protein transport
GO:0030199 IEA  collagen fibril organization
GO:0032964 IEA  collagen biosynthetic process
GO:0034505 IEA  tooth mineralization
GO:0043589 IEA  skin morphogenesis
GO:0048706 IEA  embryonic skeletal system development
GO:0060325 IEA  face morphogenesis
GO:0060346 IEA  bone trabecula formation
GO:0060351 IEA  cartilage development involved in endochondral bone morphogenesis
Molecular Function
GO:0005201 IEA  extracellular matrix structural constituent
GO:0042802 IEA  identical protein binding
GO:0048407 IEA  platelet-derived growth factor binding
Cellular Component
GO:0005576 IEA  extracellular region
GO:0005581 IEA  collagen
GO:0005584 IEA  collagen type I
GO:0005737 IEA  cytoplasm

[-] Transcripts for BT10494

BT10494-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT10494-RA View Text HTML XML
Protein: BT10494-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_001034039.1
NCBI Protein: NP_001029211.1
Ensembl Transcript: ENSBTAT00000017420
Ensembl Protein: ENSBTAP00000017420

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT10494-RA
ATGTTCAGCTTTGTGGACCTCCGGCTCCTGCTCCTCTTAGCGGCCACCGC
CCTCCTGACGCACGGCCAAGAGGAGGGCCAGGAAGAAGGCCAAGAAGAAG
ACATCCCACCAGTCACCTGCGTACAGAACGGCCTCAGGTACCATGACCGA
GACGTGTGGAAACCCGTGCCCTGCCAGATCTGTGTCTGCGACAACGGCAA
CGTGCTGTGCGATGACGTGATCTGCGACGAACTTAAGGACTGTCCTAACG
CCAAAGTCCCCACGGACGAATGCTGCCCCGTCTGCCCCGAAGGCCAGGAA
TCACCCACGGACCAAGAAACCACCGGAGTCGAGGGACCGAAAGGAGACAC
TGGCCCCCGAGGCCCAAGGGGACCCGCCGGCCCCCCCGGCCGAGATGGCA
TCCCTGGACAACCTGGACTTCCCGGACCCCCTGGACCCCCCGGACCTCCC
GGACCCCCTGGCCTCGGAGGAAACTTTGCTCCCCAGTTGTCTTACGGCTA
TGATGAGAAATCAACAGGAATTTCCGTGCCTGGTCCCATGGGTCCTTCTG
GTCCTCGTGGTCTCCCTGGCCCCCCTGGCGCACCTGGTCCCCAAGGTTTC
CAAGGCCCCCCTGGTGAGCCTGGCGAGCCAGGAGCCTCAGGTCCCATGGG
TCCCCGTGGTCCCCCTGGCCCCCCTGGCAAGAACGGAGATGATGGCGAAG
CTGGAAAGCCTGGTCGTCCTGGTGAGCGCGGGCCTCCCGGACCTCAGGGT
GCTCGGGGATTGCCTGGAACAGCTGGCCTCCCTGGAATGAAGGGACACAG
AGGTTTCAGTGGTTTGGATGGTGCCAAGGGAGATGCTGGTCCTGCTGGCC
CCAAGGGCGAGCCTGGTAGCCCCGGTGAAAATGGAGCTCCTGGTCAGATG
GGCCCCCGTGGTCTGCCTGGTGAGAGAGGTCGCCCTGGAGCCCCTGGCCC
TGCTGGTGCTCGAGGAAATGATGGTGCGACTGGTGCTGCTGGGCCCCCTG
GTCCCACTGGCCCCGCTGGTCCTCCTGGTTTCCCTGGTGCTGTGGGTGCT
AAGGGTGAAGGTGGTCCCCAAGGACCCCGAGGTTCTGAAGGTCCCCAGGG
TGTACGTGGTGAGCCTGGCCCCCCTGGCCCTGCTGGTGCTGCTGGCCCTG
CTGGCAACCCTGGTGCTGATGGACAGCCTGGTGCTAAAGGAGCCAATGGC
GCTCCTGGTATTGCTGGTGCTCCTGGCTTCCCTGGTGCCCGAGGCCCCTC
TGGACCCCAGGGCCCCAGCGGCCCCCCTGGCCCCAAGGGTAACAGCGGTG
AACCTGGTGCTCCTGGCAGCAAAGGAGACACTGGCGCCAAGGGAGAACCC
GGTCCCACTGGTATTCAAGGCCCCCCTGGCCCCGCTGGGGAAGAAGGAAA
GCGAGGAGCCCGAGGTGAACCTGGACCTGCTGGCCTGCCTGGACCCCCTG
GCGAGCGTGGTGGACCTGGAAGCCGTGGTTTCCCTGGCGCCGACGGTGTT
GCTGGTCCCAAGGGTCCTGCTGGTGAACGCGGTGCTCCTGGCCCTGCTGG
CCCCAAAGGTTCTCCTGGTGAAGCTGGTCGCCCCGGTGAAGCTGGTCTGC
CCGGTGCCAAGGGTCTGACTGGAAGCCCTGGCAGCCCGGGTCCTGATGGC
AAAACTGGCCCCCCTGGTCCCGCCGGTCAAGATGGCCGCCCTGGACCTCC
AGGCCCTCCCGGTGCCCGTGGTCAGGCTGGCGTGATGGGTTTCCCTGGAC
CTAAAGGTGCTGCTGGAGAGCCTGGAAAAGCTGGAGAGCGAGGTGTTCCT
GGACCCCCTGGCGCTGTTGGTCCTGCTGGCAAAGACGGAGAAGCTGGAGC
TCAGGGACCCCCAGGACCTGCTGGCCCCGCTGGTGAGAGAGGCGAACAAG
GCCCTGCTGGCTCCCCTGGATTCCAGGGTCTCCCCGGCCCTGCTGGTCCT
CCTGGTGAAGCAGGCAAACCTGGTGAACAGGGTGTTCCTGGAGATCTTGG
TGCCCCCGGCCCCTCTGGAGCAAGAGGCGAGAGAGGTTTCCCCGGCGAGC
GTGGTGTGCAAGGGCCGCCCGGTCCTGCAGGTCCCCGTGGGGCCAATGGT
GCCCCTGGCAACGATGGTGCTAAGGGTGATGCTGGTGCCCCTGGAGCCCC
CGGTAGCCAGGGTGCCCCTGGCCTTCAAGGAATGCCTGGTGAACGAGGTG
CAGCTGGTCTTCCAGGCCCTAAGGGTGACAGAGGGGATGCTGGTCCCAAA
GGTGCTGATGGTGCTCCTGGCAAAGATGGCGTCCGTGGTCTGACTGGTCC
CATCGGTCCTCCTGGCCCCGCTGGTGCCCCTGGTGACAAGGGTGAAGCTG
GTCCTAGTGGCCCAGCCGGTCCCACTGGAGCTCGTGGTGCCCCCGGTGAC
CGTGGTGAGCCTGGTCCCCCCGGCCCTGCTGGCTTCGCTGGCCCCCCTGG
TGCTGATGGCCAACCTGGTGCTAAAGGCGAACCTGGTGATGCTGGTGCTA
AAGGTGACGCTGGTCCCCCCGGCCCTGCTGGGCCCGCTGGACCCCCCGGC
CCCATTGGTAACGTTGGTGCTCCCGGACCCAAAGGTGCTCGTGGCAGCGC
TGGTCCCCCTGGTGCTACTGGTTTCCCAGGTGCTGCTGGCCGAGTCGGTC
CCCCCGGCCCCTCTGGAAATGCTGGACCCCCTGGCCCTCCTGGCCCTGCT
GGCAAAGAAGGCAGCAAAGGCCCCCGCGGTGAGACTGGCCCCGCTGGGCG
TCCCGGTGAAGTCGGTCCCCCTGGTCCCCCTGGCCCCGCTGGTGAGAAAG
GAGCCCCTGGTGCTGACGGACCTGCTGGAGCTCCTGGCACTCCTGGACCT
CAAGGTATTGCTGGACAGCGTGGTGTGGTCGGCCTGCCTGGTCAGAGAGG
AGAAAGAGGCTTCCCTGGTCTTCCTGGCCCCTCTGGTGAACCCGGCAAAC
AAGGTCCTTCTGGAGCAAGTGGTGAACGTGGCCCCCCTGGTCCCATGGGC
CCCCCTGGATTGGCTGGACCCCCTGGCGAGTCTGGACGTGAGGGAGCTCC
TGGTGCTGAAGGATCCCCTGGACGAGATGGTTCTCCTGGCGCCAAGGGTG
ACCGTGGTGAGACCGGCCCTGCTGGACCTCCTGGTGCTCCTGGCGCTCCC
GGTGCCCCCGGCCCTGTCGGACCTGCCGGCAAGAGCGGTGATCGTGGTGA
GACCGGTCCTGCTGGTCCTGCTGGTCCCATTGGCCCCGTTGGTGCCCGTG
GCCCCGCTGGACCCCAAGGCCCCCGTGGTGACAAGGGTGAGACAGGCGAA
CAGGGCGACAGAGGCATTAAGGGTCACCGTGGCTTCTCTGGTCTCCAGGG
TCCCCCCGGCCCTCCCGGCTCTCCTGGTGAGCAAGGTCCTTCCGGAGCCT
CTGGTCCTGCTGGTCCCCGCGGTCCCCCTGGCTCTGCTGGTTCTCCCGGC
AAAGATGGACTCAATGGTCTCCCAGGCCCCATCGGTCCCCCTGGGCCTCG
AGGTCGCACTGGTGATGCTGGTCCTGCTGGTCCTCCCGGCCCTCCTGGAC
CCCCTGGTCCCCCAGGTCCTCCCAGCGGCGGCTACGACTTGAGCTTCCTG
CCCCAGCCACCTCAAGAGAAGGCTCACGATGGTGGCCGCTACTACCGGGC
TGATGATGCCAATGTGGTCCGTGACCGTGACCTCGAGGTGGACACCACCC
TCAAGAGCCTGAGCCAGCAGATCGAGAACATCCGGAGCCCTGAAGGCAGC
CGCAAGAACCCCGCCCGCACCTGCCGTGACCTCAAGATGTGCCACTCTGA
CTGGAAGAGCGGAGAATACTGGATTGACCCCAACCAAGGCTGCAACCTGG
ATGCCATTAAGGTCTTCTGCAACATGGAAACCGGTGAGACCTGTGTATAC
CCCACTCAGCCCAGCGTGGCCCAGAAGAACTGGTATATCAGCAAGAACCC
CAAGGAAAAGAGGCACGTCTGGTACGGCGAGAGCATGACCGGCGGATTCC
AGTTCGAGTATGGCGGCCAGGGGTCCGATCCTGCCGATGTGGCCATCCAG
CTGACTTTCCTGCGCCTGATGTCCACCGAGGCCTCCCAGAACATCACCTA
CCACTGCAAGAACAGCGTGGCCTACATGGACCAGCAGACTGGCAACCTCA
AGAAGGCCCTGCTCCTCCAGGGCTCCAACGAGATCGAGATCCGGGCCGAG
GGCAACAGCCGCTTCACCTACAGCGTCACCTACGATGGCTGCACGAGTCA
CACCGGAGCCTGGGGCAAGACAGTGATCGAATACAAAACCACCAAGACCT
CCCGCTTGCCCATCATCGATGTGGCCCCCTTGGACGTTGGCGCCCCAGAC
CAGGAATTCGGCTTCGACGTTGGCCCTGCCTGCTTCCTG



Protein Sequences

>BT10494-PA
MFSFVDLRLLLLLAATALLTHGQEEGQEEGQEEDIPPVTCVQNGLRYHDR
DVWKPVPCQICVCDNGNVLCDDVICDELKDCPNAKVPTDECCPVCPEGQE
SPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPP
GPPGLGGNFAPQLSYGYDEKSTGISVPGPMGPSGPRGLPGPPGAPGPQGF
QGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPGPQG
ARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQM
GPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGA
KGEGGPQGPRGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANG
APGIAGAPGFPGARGPSGPQGPSGPPGPKGNSGEPGAPGSKGDTGAKGEP
GPTGIQGPPGPAGEEGKRGARGEPGPAGLPGPPGERGGPGSRGFPGADGV
AGPKGPAGERGAPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDG
KTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGVP
GPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGP
PGEAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANG
APGNDGAKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPK
GADGAPGKDGVRGLTGPIGPPGPAGAPGDKGEAGPSGPAGPTGARGAPGD
RGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGPPGPAGPAGPPG
PIGNVGAPGPKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPA
GKEGSKGPRGETGPAGRPGEVGPPGPPGPAGEKGAPGADGPAGAPGTPGP
QGIAGQRGVVGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMG
PPGLAGPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPAGPPGAPGAP
GAPGPVGPAGKSGDRGETGPAGPAGPIGPVGARGPAGPQGPRGDKGETGE
QGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGSPG
KDGLNGLPGPIGPPGPRGRTGDAGPAGPPGPPGPPGPPGPPSGGYDLSFL
PQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGS
RKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVY
PTQPSVAQKNWYISKNPKEKRHVWYGESMTGGFQFEYGGQGSDPADVAIQ
LTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQGSNEIEIRAE
GNSRFTYSVTYDGCTSHTGAWGKTVIEYKTTKTSRLPIIDVAPLDVGAPD
QEFGFDVGPACFL




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.