BT10628

Link to gene wiki page

[-] General Information


Transcripts for BT10628 BT10628-RA   BT10628-RB  

NCBI Gene Symbol: NEU3

Description:
sialidase 3 (membrane sialidase)

Overlapping Locus Information:

NCBI: 281349

Genomic Location: Chr15.53   625561 .. 640089    [+]

GO Annotations for BT10628

Biological Process
GO:0005975 IEA  carbohydrate metabolic process
GO:0008152 IEA  metabolic process
Molecular Function
GO:0004308 IEA  exo-alpha-sialidase activity
GO:0016798 IEA  hydrolase activity, acting on glycosyl bonds
Cellular Component
GO:0005886 IEA  plasma membrane
GO:0019898 IEA  extrinsic to membrane

[-] Transcripts for BT10628

BT10628-RA

Gene Model Source: Manual 
OGSv1 ID: GLEAN_11039 

Sequences:

Transcript: BT10628-RA View Text HTML XML
Protein: BT10628-PA View Text HTML XML

User Submitted Information:

Submitter Name: Bruce Southey
Submitter ID: bsouthey
Temporary ID: Btgn_tempid_1449-PA
Submitted Name: NEU3

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

BT10628-RB

Gene Model Source: RefSeq 

Sequences:

Transcript: BT10628-RB View Text HTML XML
Protein: BT10628-PB View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_174122.2
NCBI Protein: NP_776547.1
Ensembl Transcript: ENSBTAT00000036738
Ensembl Protein: ENSBTAP00000036593

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT10628-RA
ATGGAGGAGCCGGGGTTCCCTGCAGAGGTCATGGAAGAAGTGACATCATG
CTCCTTCAGCAGCCCTCTGTTCCAGCAGGAGGACAAGAGAGGGGTCACCT
ACCGGATCCCAGCCCTGATCTACGTGCCCCCTGCCCACACCTTCCTGGCC
TTTGCAGAGAAGCGCTCCTCGAGCAAGGATGAGGATGCTCTCCACCTGGT
GCTGAGGCGAGGATTAAGGACTGGGCAATCAGTACAGTGGGAACCCCTGA
AGTCCCTGATGAAAGCCACGTTACCTGGACACCGGACCATGAACCCCTGT
CCTGTGTGGGAGCGGAAGAGTGGCTACGTGTACCTGTTCTTCATCTGTGT
GCAAGGCCATGTCACCGAGCGTCAACAGATTATGTCAGGCAGGAACGCTG
CACGCCTCTGCTTCATATGCAGCCAGGATGCTGGCTATTCATGGAGTGAT
GTGAGGGACCTGACTGAGGAGGTCATTGGCCCAGAGGTGACACACTGGGC
CACTTTTGCTGTGGGGCCAGGTCATGGCATCCAGCTGCAGTCGGGGAGGC
TCATCATCCCTGCATATGCCTACTACATCCCGTTCTGGTTCTTTTGCTTT
CGGCTGCCATATAGAGCTAGGCCTCATTCCCTGATGATCTATAGCGATGA
CCTAGGAGCCACATGGCACCATGGCAGGCTTATCAAGCCCATGGTGACAG
TGGAATGTGAAGTGGCAGAGGTGATCGGGAAGGCCGGCCACCCTGTGCTG
TATTGCAGTGCCCGGACACCAAACAGGCACCGGGCAGAGGCCCTCAGCAT
TGACCATGGTGAATGCTTTCAGAAACCAGTCCTGAGCCATCAGCTCTGTG
AGCCCCCTCATGGCTGTCAAGGCAGTGTGGTGAGTTTCTGTCCCCTGGAG
ATCCCAGGTGGATGCCAGAATCTTGCTGGCGAAGATGCACCTGCCATTCA
GCAGAGTCCTCTGCTGTGCAGCTCAGTGAGACCAGAGCCGGAAGCTGGAA
CCCTGTCAGAATCATGGCTCTTGTACTCACACCCAACCAATAAGAAACGG
AGGGTCGATCTAGGCATCTACCTCAACCAGAGCCCCTTGGAGGCTGCCTG
CTGGTCCCGCCCCTGGATCTTGCACTGCGGGCCCTGTGGGTACTCTGATT
TGGCTGCTCTGGAGAATGAGGGCTTGTTTGGGTGTTTGTTTGAATGTGGG
ACCAAGCAGGAGTGTGAGCAGATTGCCTTCCGCCTGTTTACAGACCGAGA
GATCCTGAGCCACGTGCAAGGGGACTGCTCCACCCCTGGTATGAACTCTG
AGCCAAGTAAAAAGTAA


>BT10628-RB
ATGGAAGAAGTGACATCATGCTCCTTCAGCAGCCCTCTGTTCCAGCAGGA
GGACAAGAGAGGGGTCACCTACCGGATCCCAGCCCTGATCTACGTGCCCC
CTGCCCACACCTTCCTGGCCTTTGCAGAGAAGCGCTCCTCGAGCAAGGAT
GAGGATGCTCTCCACCTGGTGCTGAGGCGAGGATTAAGGACTGGGCAATC
AGTACAGTGGGAACCCCTGAAGTCCCTGATGAAAGCCACGTTACCTGGAC
ACCGGACCATGAACCCCTGTCCTGTGTGGGAGCGGAAGAGTGGCTACGTG
TACCTGTTCTTCATCTGTGTGCAAGGCCATGTCACCGAGCGTCAACAGAT
TATGTCAGGCAGGAACGCTGCACGCCTCTGCTTCATATGCAGCCAGGATG
CTGGCTATTCATGGAGTGATGTGAGGGACCTGACTGAGGAGGTCATTGGC
CCAGAGGTGACACACTGGGCCACTTTTGCTGTGGGGCCAGGTCATGGCAT
CCAGCTGCAGTCGGGGAGGCTCATCATCCCTGCATATGCCTACTACATCC
CGTTCTGGTTCTTTTGCTTTCGGCTGCCATATAGAGCTAGGCCTCATTCC
CTGATGATCTATAGCGATGACCTAGGAGCCACATGGCACCATGGCAGGCT
TATCAAGCCCATGGTGACAGTGGAATGTGAAGTGGCAGAGGTGATCGGGA
AGGCCGGCCACCCTGTGCTGTATTGCAGTGCCCGGACACCAAACAGGCAC
CGGGCAGAGGCCCTCAGCATTGACCATGGTGAATGCTTTCAGAAACCAGT
CCTGAGCCATCAGCTCTGTGAGCCCCCTCATGGCTGTCAAGGCAGTGTGG
TGAGTTTCTGTCCCCTGGAGATCCCAGGTGGATGCCAGAATCTTGCTGGC
GAAGATGCACCTGCCATTCAGCAGAGTCCTCTGCTGTGCAGCTCAGTGAG
ACCAGAGCCGGAAGCTGGAACCCTGTCAGAATCATGGCTCTTGTACTCAC
ACCCAACCAATAAGAAACGGAGGGTCGATCTAGGCATCTACCTCAACCAG
AGCCCCTTGGAGGCTGCCTGCTGGTCCCGCCCCTGGATCTTGCACTGCGG
GCCCTGTGGGTACTCTGATTTGGCTGCTCTGGAGAATGAGGGCTTGTTTG
GGTGTTTGTTTGAATGTGGGACCAAGCAGGAGTGTGAGCAGATTGCCTTC
CGCCTGTTTACAGACCGAGAGATCCTGAGCCACGTGCAAGGGGACTGCTC
CACCCCTGGTATGAACTCTGAGCCAAGTAAAAAG



Protein Sequences

>BT10628-PA
MEEPGFPAEVMEEVTSCSFSSPLFQQEDKRGVTYRIPALIYVPPAHTFLA
FAEKRSSSKDEDALHLVLRRGLRTGQSVQWEPLKSLMKATLPGHRTMNPC
PVWERKSGYVYLFFICVQGHVTERQQIMSGRNAARLCFICSQDAGYSWSD
VRDLTEEVIGPEVTHWATFAVGPGHGIQLQSGRLIIPAYAYYIPFWFFCF
RLPYRARPHSLMIYSDDLGATWHHGRLIKPMVTVECEVAEVIGKAGHPVL
YCSARTPNRHRAEALSIDHGECFQKPVLSHQLCEPPHGCQGSVVSFCPLE
IPGGCQNLAGEDAPAIQQSPLLCSSVRPEPEAGTLSESWLLYSHPTNKKR
RVDLGIYLNQSPLEAACWSRPWILHCGPCGYSDLAALENEGLFGCLFECG
TKQECEQIAFRLFTDREILSHVQGDCSTPGMNSEPSKK


>BT10628-PB
MEEVTSCSFSSPLFQQEDKRGVTYRIPALIYVPPAHTFLAFAEKRSSSKD
EDALHLVLRRGLRTGQSVQWEPLKSLMKATLPGHRTMNPCPVWERKSGYV
YLFFICVQGHVTERQQIMSGRNAARLCFICSQDAGYSWSDVRDLTEEVIG
PEVTHWATFAVGPGHGIQLQSGRLIIPAYAYYIPFWFFCFRLPYRARPHS
LMIYSDDLGATWHHGRLIKPMVTVECEVAEVIGKAGHPVLYCSARTPNRH
RAEALSIDHGECFQKPVLSHQLCEPPHGCQGSVVSFCPLEIPGGCQNLAG
EDAPAIQQSPLLCSSVRPEPEAGTLSESWLLYSHPTNKKRRVDLGIYLNQ
SPLEAACWSRPWILHCGPCGYSDLAALENEGLFGCLFECGTKQECEQIAF
RLFTDREILSHVQGDCSTPGMNSEPSKK




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.