BT10752

Link to gene wiki page

[-] General Information


Transcripts for BT10752 BT10752-RA   BT10752-RB  

NCBI Gene Symbol: CCL2

Description:
chemokine (C-C motif) ligand 2

Overlapping Locus Information:

NCBI: 281043
Ensembl: ENSBTAG00000037811

Genomic Location: Chr19.11   591910 .. 593308    [-]

GO Annotations for BT10752

Biological Process
GO:0002548 IEA  monocyte chemotaxis
GO:0006916 IEA  anti-apoptosis
GO:0006935 IEA  chemotaxis
GO:0006955 IEA  immune response
GO:0009617 IEA  response to bacterium
GO:0048246 IEA  macrophage chemotaxis
Molecular Function
GO:0001664 IEA  G-protein-coupled receptor binding
GO:0005515 IEA  protein binding
GO:0008009 IEA  chemokine activity
Cellular Component
GO:0005576 IEA  extracellular region
GO:0005615 IEA  extracellular space

[-] Transcripts for BT10752

BT10752-RA

Gene Model Source: Manual 
OGSv1 ID: GLEAN_07860 

Sequences:

Transcript: BT10752-RA View Text HTML XML
Protein: BT10752-PA View Text HTML XML

User Submitted Information:

Submitter Name: Tatiana Amabile de Campos
Submitter ID: tacmps
Temporary ID: Btgn_tempid_2196-PB

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

BT10752-RB

Gene Model Source: GLEAN 

Sequences:

Transcript: BT10752-RB View Text HTML XML
Protein: BT10752-PB View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_174006.2
NCBI Protein: NP_776431.1
Ensembl Transcript: ENSBTAT00000013146
Ensembl Protein: ENSBTAP00000013146

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT10752-RA
CCAACAGCTTCCACGCTGAAACTTGAATCCTCTCGCTGCAACATGAAGGT
CTCCGCTGCCCTCCTGTGCCTGCTACTCACAGTAGCTGCCTTCAGCACCG
AGGTGCTCGCTCAGCCAGATGCAATTAACTCCCAAGTCGCCTGCTGCTAT
ACATTCAACAGTAAGAAGATCTCCATGCAGAGGCTGATGAACTACAGAAG
AGTCACCAGCAGCAAGTGTCCTAAAGAGGCTGTGATTTTCAAGACCATCC
TGGGCAAGGAGTTATGTGCAGACCCCAAGCAGAAATGGGTCCAGGACTCC
ATAAACTATCTTAACAAGAAAAACCAAACTCCAAAGCCT


>BT10752-RB
ATGAAGGTCTCCGCTGCCCTCCTGTGCCTGCTACTCACAGTAGCTGCCTT
CAGCACCGAGGTGCTCGCTCAGCCAGATGCAATTAACTCCCAAGTCGCCT
GCTGCTATACATTCAACAGTAAGAAGATCTCCATGCAGAGGCTGATGAAC
TACAGAAGAGTCACCAGCAGCAAGTGTCCTAAAGAGGCTGTGATTTTCAA
GACCATCCTGGGCAAGGAGTTATGTGCAGACCCCAAGCAGAAATGGGTCC
AGGACTCCATAAACTATCTTAACAAGAAAAACCAAACTCCAAAGCCT



Protein Sequences

>BT10752-PA
PTASTLKLESSRCNMKVSAALLCLLLTVAAFSTEVLAQPDAINSQVACCY
TFNSKKISMQRLMNYRRVTSSKCPKEAVIFKTILGKELCADPKQKWVQDS
INYLNKKNQTPKP


>BT10752-PB
MKVSAALLCLLLTVAAFSTEVLAQPDAINSQVACCYTFNSKKISMQRLMN
YRRVTSSKCPKEAVIFKTILGKELCADPKQKWVQDSINYLNKKNQTPKP




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.