BT10832

Link to gene wiki page

[-] General Information


Transcripts for BT10832 BT10832-RA  

NCBI Gene Symbol: COL3A1

Description:
collagen, type III, alpha 1

Overlapping Locus Information:

NCBI: 510833
Ensembl: ENSBTAG00000021466

Genomic Location: Chr2.8   598744 .. 637363    [-]

GO Annotations for BT10832

Biological Process
GO:0001568 IEA  blood vessel development
GO:0007160 IEA  cell-matrix adhesion
GO:0007179 IEA  transforming growth factor beta receptor signaling pathway
GO:0007229 IEA  integrin-mediated signaling pathway
GO:0007507 IEA  heart development
GO:0009314 IEA  response to radiation
GO:0018149 IEA  peptide cross-linking
GO:0030199 IEA  collagen fibril organization
GO:0034097 IEA  response to cytokine stimulus
GO:0043206 IEA  fibril organization
GO:0043588 IEA  skin development
GO:0048565 IEA  gut development
GO:0050777 IEA  negative regulation of immune response
Molecular Function
GO:0005178 IEA  integrin binding
GO:0005201 IEA  extracellular matrix structural constituent
GO:0046332 IEA  SMAD binding
GO:0048407 IEA  platelet-derived growth factor binding
Cellular Component
GO:0005581 IEA  collagen
GO:0005586 IEA  collagen type III
GO:0031012 IEA  extracellular matrix

[-] Transcripts for BT10832

BT10832-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT10832-RA View Text HTML XML
Protein: BT10832-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_001076831.1
NCBI Protein: NP_001070299.1

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT10832-RA
ATGATGAGCTTTGTGCAAAAGGGGACCTGGTTACTTTTCGCTCTGCTTCA
TCCCACTGTTATTTTGGCACAACAGGAAGCTGTTGACGGAGGATGCTCCC
ATCTCGGTCAGTCTTATGCAGATAGAGATGTATGGAAACCAGAACCGTGC
CAAATATGCGTCTGTGACTCAGGATCCGTTCTCTGTGATGACATAATATG
TGACGACCAAGAATTAGACTGCCCCAACCCTGAAATCCCGTTTGGAGAAT
GTTGTGCAGTTTGCCCACAGCCTCCAACAGCTCCCACTCGCCCTCCTAAT
GGTCAAGGACCTCAAGGCCCCAAGGGAGATCCAGGTCCTCCTGGTATTCC
TGGGCGAAATGGCGATCCTGGTCCTCCAGGATCACCAGGCTCCCCAGGTT
CTCCCGGCCCTCCTGGAATCTGTGAATCATGTCCTACTGGTGGCCAGAAC
TATTCTCCCCAGTACGAAGCATATGATGTCAAGTCTGGAGTAGCAGGAGG
AGGAATCGCAGGCTATCCTGGGCCAGCTGGTCCTCCTGGCCCACCCGGAC
CCCCTGGCACATCTGGCCATCCTGGTGCCCCTGGCGCTCCAGGATACCAA
GGTCCCCCCGGTGGACCTGGGCAAGCTGGTCCGGCAGGTCCTCCAGGACC
TCCTGGTGCTATAGGTCCATCTGGCCCTGCTGGAAAAGATGGGGAATCAG
GAAGACCCGGACGACCTGGAGAGCGAGGATTTCCTGGCCCTCCTGGTATG
AAAGGCCCAGCTGGTATGCCTGGATTCCCTGGTATGAAAGGACACAGAGG
CTTTGATGGACGAAATGGAGAGAAAGGCGAAACTGGTGCTCCTGGATTAA
AGGGGGAAAATGGCGTTCCAGGTGAAAATGGAGCTCCTGGACCCATGGGT
CCAAGAGGGGCTCCCGGTGAGAGAGGACGGCCAGGACTTCCTGGAGCCGC
AGGGGCTCGAGGTAATGATGGAGCTCGAGGAAGTGATGGACAACCGGGCC
CCCCTGGTCCTCCTGGAACTGCAGGATTCCCTGGTTCCCCTGGTGCTAAG
GGTGAAGTTGGACCTGCAGGATCTCCTGGTTCAAGTGGCGCCCCTGGACA
AAGAGGAGAACCTGGACCTCAGGGACATGCTGGTGCTCCAGGTCCCCCTG
GGCCTCCTGGGAGTAATGGTAGTCCTGGTGGCAAAGGTGAAATGGGTCCT
GCTGGCATTCCTGGGGCTCCTGGGCTGATAGGAGCTCGTGGTCCTCCAGG
GCCACCTGGCACCAATGGTGTTCCCGGGCAACGAGGTGCTGCAGGTGAAC
CCGGTAAGAATGGAGCCAAAGGAGACCCAGGACCACGTGGGGAACGCGGA
GAAGCTGGTTCTCCAGGTATCGCAGGACCTAAGGGTGAAGATGGCAAAGA
TGGTTCTCCTGGAGAACCTGGTGCAAATGGACTTCCTGGAGCTGCAGGAG
AAAGGGGTGTGCCTGGATTCCGAGGACCTGCTGGAGCAAATGGCCTTCCA
GGAGAAAAGGGTCCTCCTGGGGACCGTGGTGGCCCAGGCCCTGCAGGGCC
CAGAGGTGTTGCTGGAGAGCCCGGCAGAGATGGTCTCCCTGGAGGTCCAG
GATTGAGGGGTATTCCTGGTAGCCCCGGAGGACCAGGCAGTGATGGGAAA
CCAGGGCCTCCTGGAAGCCAAGGAGAGACGGGTCGACCCGGTCCTCCAGG
TTCACCTGGTCCGCGAGGCCAGCCTGGTGTCATGGGCTTCCCTGGTCCCA
AAGGAAACGATGGTGCTCCTGGAAAAAATGGAGAACGAGGTGGCCCTGGA
GGTCCTGGCCCTCAGGGTCCTGCTGGAAAGAATGGTGAGACCGGACCTCA
GGGTCCTCCAGGACCTACTGGCCCTTCTGGTGACAAAGGAGACACAGGAC
CCCCTGGTCCACAAGGACTACAAGGCTTGCCTGGAACGAGTGGTCCCCCA
GGAGAAAACGGAAAACCTGGTGAACCTGGTCCAAAGGGTGAGGCTGGTGC
ACCTGGAATTCCAGGAGGCAAGGGTGATTCTGGTGCTCCCGGTGAACGCG
GACCTCCTGGAGCAGGAGGGCCCCCTGGACCTAGAGGTGGAGCTGGCCCC
CCTGGTCCCGAAGGAGGAAAGGGTGCTGCTGGTCCCCCTGGGCCACCTGG
TTCTGCTGGTACACCTGGTCTGCAAGGAATGCCTGGAGAAAGAGGGGGTC
CTGGAGGCCCTGGTCCAAAGGGTGATAAGGGTGAGCCTGGCAGCTCAGGT
GTCGATGGTGCTCCAGGGAAAGATGGTCCACGGGGTCCCACTGGTCCCAT
TGGTCCTCCTGGCCCAGCTGGTCAGCCTGGAGATAAGGGTGAAAGTGGTG
CCCCTGGAGTTCCGGGTATAGCTGGTCCTCGCGGTGGCCCTGGTGAGAGA
GGCGAACAGGGGCCCCCAGGACCTGCTGGCTTCCCTGGTGCTCCTGGCCA
GAATGGTGAGCCTGGTGCTAAAGGAGAAAGAGGCGCTCCTGGTGAGAAAG
GTGAAGGAGGCCCTCCCGGAGCCGCAGGACCCGCCGGAGGTTCTGGGCCT
GCCGGTCCCCCAGGCCCCCAAGGTGTCAAAGGCGAACGTGGCAGTCCTGG
TGGTCCTGGTGCTGCTGGCTTCCCCGGTGGTCGTGGTCCTCCTGGCCCTC
CTGGCAGTAATGGTAACCCAGGCCCCCCAGGCTCCAGTGGTGCTCCAGGC
AAAGATGGTCCCCCAGGTCCACCTGGCAGTAATGGTGCTCCTGGCAGCCC
CGGGATCTCTGGACCAAAGGGTGATTCTGGTCCACCAGGTGAGAGGGGAG
CACCTGGCCCCCAGGGCCCTCCGGGAGCTCCAGGCCCACTAGGAATTGCA
GGACTTACTGGAGCACGAGGTCTTGCAGGCCCACCAGGCATGCCAGGTGC
TAGGGGCAGCCCCGGCCCACAGGGCATCAAGGGTGAAAATGGTAAACCAG
GACCTAGTGGTCAGAATGGAGAACGTGGTCCTCCTGGCCCCCAGGGTCTT
CCTGGTCTGGCTGGTACAGCTGGTGAGCCTGGAAGAGATGGAAACCCTGG
ATCAGATGGTCTGCCAGGCCGAGATGGAGCTCCAGGTGCCAAGGGTGACC
GTGGTGAAAATGGCTCTCCTGGTGCCCCTGGAGCTCCTGGTCACCCAGGC
CCTCCTGGTCCTGTCGGTCCAGCTGGAAAGAGCGGTGACAGAGGAGAAAC
TGGCCCTGCTGGTCCTTCTGGGGCCCCCGGTCCTGCCGGATCAAGAGGTC
CTCCTGGTCCCCAAGGCCCACGCGGTGACAAAGGGGAAACCGGTGAGCGT
GGTGCTATGGGCATCAAAGGACATCGCGGATTCCCTGGCAACCCAGGGGC
CCCCGGATCTCCGGGTCCCGCTGGTCATCAAGGTGCAGTTGGCAGTCCAG
GCCCTGCAGGCCCCAGAGGACCTGTTGGACCTAGCGGGCCCCCTGGAAAG
GACGGAGCAAGTGGACACCCTGGTCCCATTGGACCACCGGGGCCCCGAGG
TAACAGAGGTGAAAGAGGATCTGAGGGCTCCCCAGGCCACCCAGGACAAC
CAGGCCCTCCTGGACCTCCTGGTGCCCCTGGTCCATGTTGTGGTGCTGGC
GGGGTTGCTGCCATTGCTGGTGTTGGAGCCGAAAAAGCTGGTGGTTTTGC
CCCATATTATGGAGATGAACCGATAGATTTCAAAATCAACACCGATGAGA
TTATGACCTCACTCAAATCAGTCAATGGACAAATAGAAAGCCTCATTAGT
CCTGATGGTTCCCGTAAAAACCCTGCACGGAACTGCAGGGACCTGAAATT
CTGCCATCCTGAACTCCAGAGTGGAGAATATTGGGTTGATCCTAACCAAG
GTTGCAAATTGGATGCTATTAAAGTCTACTGTAACATGGAAACTGGGGAA
ACGTGCATAAGTGCCAGTCCTTTGACTATCCCACAGAAGAACTGGTGGAC
AGATTCTGGTGCTGAGAAGAAACATGTTTGGTTTGGAGAATCCATGGAGG
GTGGTTTTCAGTTTAGCTATGGCAATCCTGAACTTCCCGAAGACGTCCTC
GATGTCCAGCTGGCATTCCTCCGACTTCTCTCCAGCCGGGCCTCTCAGAA
CATCACATATCACTGCAAGAATAGCATTGCATACATGGATCATGCCAGTG
GGAATGTAAAGAAAGCCTTGAAGCTGATGGGGTCAAATGAAGGTGAATTC
AAGGCTGAAGGAAATAGCAAATTCACATACACAGTTCTGGAGGATGGTTG
CACAAAACACACTGGGGAATGGGGCAAAACAGTCTTCCAGTATCAAACAC
GCAAGGCCGTCAGACTACCTATTGTAGATATTGCACCCTATGATATCGGT
GGTCCTGATCAAGAATTTGGTGCGGACATTGGCCCTGTTTGCTTTTTA



Protein Sequences

>BT10832-PA
MMSFVQKGTWLLFALLHPTVILAQQEAVDGGCSHLGQSYADRDVWKPEPC
QICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPN
GQGPQGPKGDPGPPGIPGRNGDPGPPGSPGSPGSPGPPGICESCPTGGQN
YSPQYEAYDVKSGVAGGGIAGYPGPAGPPGPPGPPGTSGHPGAPGAPGYQ
GPPGGPGQAGPAGPPGPPGAIGPSGPAGKDGESGRPGRPGERGFPGPPGM
KGPAGMPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGVPGENGAPGPMG
PRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAK
GEVGPAGSPGSSGAPGQRGEPGPQGHAGAPGPPGPPGSNGSPGGKGEMGP
AGIPGAPGLIGARGPPGPPGTNGVPGQRGAAGEPGKNGAKGDPGPRGERG
EAGSPGIAGPKGEDGKDGSPGEPGANGLPGAAGERGVPGFRGPAGANGLP
GEKGPPGDRGGPGPAGPRGVAGEPGRDGLPGGPGLRGIPGSPGGPGSDGK
PGPPGSQGETGRPGPPGSPGPRGQPGVMGFPGPKGNDGAPGKNGERGGPG
GPGPQGPAGKNGETGPQGPPGPTGPSGDKGDTGPPGPQGLQGLPGTSGPP
GENGKPGEPGPKGEAGAPGIPGGKGDSGAPGERGPPGAGGPPGPRGGAGP
PGPEGGKGAAGPPGPPGSAGTPGLQGMPGERGGPGGPGPKGDKGEPGSSG
VDGAPGKDGPRGPTGPIGPPGPAGQPGDKGESGAPGVPGIAGPRGGPGER
GEQGPPGPAGFPGAPGQNGEPGAKGERGAPGEKGEGGPPGAAGPAGGSGP
AGPPGPQGVKGERGSPGGPGAAGFPGGRGPPGPPGSNGNPGPPGSSGAPG
KDGPPGPPGSNGAPGSPGISGPKGDSGPPGERGAPGPQGPPGAPGPLGIA
GLTGARGLAGPPGMPGARGSPGPQGIKGENGKPGPSGQNGERGPPGPQGL
PGLAGTAGEPGRDGNPGSDGLPGRDGAPGAKGDRGENGSPGAPGAPGHPG
PPGPVGPAGKSGDRGETGPAGPSGAPGPAGSRGPPGPQGPRGDKGETGER
GAMGIKGHRGFPGNPGAPGSPGPAGHQGAVGSPGPAGPRGPVGPSGPPGK
DGASGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGAG
GVAAIAGVGAEKAGGFAPYYGDEPIDFKINTDEIMTSLKSVNGQIESLIS
PDGSRKNPARNCRDLKFCHPELQSGEYWVDPNQGCKLDAIKVYCNMETGE
TCISASPLTIPQKNWWTDSGAEKKHVWFGESMEGGFQFSYGNPELPEDVL
DVQLAFLRLLSSRASQNITYHCKNSIAYMDHASGNVKKALKLMGSNEGEF
KAEGNSKFTYTVLEDGCTKHTGEWGKTVFQYQTRKAVRLPIVDIAPYDIG
GPDQEFGADIGPVCFL




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.