BT11120

Link to gene wiki page

[-] General Information


Transcripts for BT11120 BT11120-RA   BT11120-RB  

NCBI Gene Symbol: PCSK1

Description:
proprotein convertase subtilisin/kexin type 1

Overlapping Locus Information:

NCBI: 281967

Genomic Location: Chr7.109   482364 .. 527503    [-]

GO Annotations for BT11120

Biological Process
GO:0006508 IEA  proteolysis
GO:0016486 IEA  peptide hormone processing
GO:0043043 IEA  peptide biosynthetic process
Molecular Function
GO:0004252 IEA  serine-type endopeptidase activity
GO:0005509 IEA  calcium ion binding
GO:0008233 IEA  peptidase activity
Cellular Component
GO:0005615 IEA  extracellular space
GO:0030141 IEA  secretory granule
GO:0031410 IEA  cytoplasmic vesicle

[-] Transcripts for BT11120

BT11120-RA

Gene Model Source: Manual 
OGSv1 ID: GLEAN_21961 

Sequences:

Transcript: BT11120-RA View Text HTML XML
Protein: BT11120-PA View Text HTML XML

User Submitted Information:

Submitter Name: Bruce Southey
Submitter ID: bsouthey
Temporary ID: Btgn_tempid_3192-PB
Submitted Name: PCSK1

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

BT11120-RB

Gene Model Source: RefSeq 
OGSv1 ID: GLEAN_21961 

Sequences:

Transcript: BT11120-RB View Text HTML XML
Protein: BT11120-PB View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_174412.2
NCBI Protein: NP_776837.1
Ensembl Transcript: ENSBTAT00000027775
Ensembl Protein: ENSBTAP00000027775

User Submitted Information:

Submitter Name: Elisa Marques
Submitter ID: emarques
Temporary ID: Btgn_tempid_3192-PA

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT11120-RA
ATGGGGCGAAGAGCCTGGACTCTGCAGTGTACTGCTTTCTCTCTGTTTTG
CGCTTGGTGTGCAATGAACAGTGTAAAAGCGAAGAGGCAGTTTGTGAATG
AATGGGCGGCGGAGATCCCCGGGGGACCTGAGGCAGCCTCGGCGATAGCC
CAGGAGCTAGGCTATGACCTTTTGGGTCAGATTGGATCACTTGAAAATCA
CTACTTATTCAAACACAGAAACCATCCTCGGAGGTCTCGAAGGAGTGCCC
TTCACATCACTAAGAGATTGTCTGATGATGATCGTGTGATATGGGCGGAA
CAACAGTATGAAAAAGAAAGAAGTAAACGTTCAGTTCTAAGAGACTCAGC
ACTAGATCTCTTCAATGATCCGATGTGGAATCAGCAGTGGTACTTGCAAG
ATACAAGGATGACTGCAACCCTGCCCAAGCTGGATCTCCATGTGATACCT
GTTTGGCAAAAAGGCATCACAGGCAAAGGTGTTGTTATCACTGTATTGGA
TGATGGCTTGGAGTGGAATCACACAGACATCTATGCCAACTATGATCCGG
AGGCCAGCTATGATTTTAACGATAATGACCATGATCCATTTCCCCGATAT
GATCCCACAAATGAGAACAAACATGGAACCAGATGTGCAGGAGAAATTGC
GATGCAAGCAAATAATCACAAGTGTGGGGTCGGAGTTGCATACAATTCCA
AAGTTGGAGGCATAAGAATGCTAGATGGCATTGTGACCGATGCTATTGAA
GCCAGCTCAATTGGATTTAATCCTGGGCATGTGGATATTTACAGCGCAAG
CTGGGGCCCTAACGATGACGGGAAAACTGTGGAGGGGCCTGGTCGACTGG
CCCAGAAGGCTTTTGAATATGGTGTCAAACAGGGCAGACAAGGAAAGGGC
TCTATCTTCGTCTGGGCCTCCGGGAACGGGGGGCGTCAGGGAGACAACTG
TGACTGCGACGGGTACACGGACAGCATCTATACCATCTCCATCAGCAGTG
CCTCGCAGCAAGGCCTATCCCCCTGGTACGCAGAGAAGTGCTCCTCCACG
CTGGCCACCTCCTACAGCAGTGGGGACTACACTGACCAGCGAATCACGAG
CGCTGACCTGCACAACGACTGCACGGAGACCCATACGGGCACCTCAGCCT
CTGCACCCCTGGCCGCTGGCATCTTCGCTCTAGCCCTGGAAGCAAATCCC
AATCTCACCTGGCGAGATATGCAGCACTTGGTTGTATGGACCTCTGAGTA
TGACCCACTGGCCAATAACCCTGGATGGAAAAAGAACGGAGCAGGCTTGA
TGGTGAACAGTCGATTTGGATTCGGGCTGCTAAATGCCAAAGCTCTGGTG
GATTTGGCTGATCCCAGCACCTGGAGCAGTGTGCCTGAGAAGAAGGAATG
TGTTGTCAAGGACAATGACTTTGAGCCCAGAGCCCTGAAAGCTAATGGAG
AAGTCATCATAGAAATTCCAACAAGAGCTTGTGAAGGTCAAGAAAATGCT
ATCAAGTCACTGGAACATGTGCAATTTGAAGCAACAATTGAATATTCCCG
CAGAGGAGACCTTCATGTCACCCTCACTTCGGCCGCTGGAACCAGCACCG
TACTGTTGGCTGAAAGAGAGCGGGACACCTCTCCCAATGGCTTTAAGAAC
TGGGACTTCATGTCTGTTCACACGTGGGGAGAGAACCCAATAGGCACTTG
GACTTTGCGAATTGCAGACATGTCTGGAAGACTGCAAAACGAAGGAAGAA
TCGTGACCTGGAAGCTGATCCTGCACGGGACCTCTTCCCAGCCAGAGCAC
ATGAAACAGCCCCGGGTGTACACGTCTTACAACACCGTGCAGAACGACCG
AAGAGGCGTGGAGAAGGTGGTGGACTCCGGGGAGGAGCAGCCTACACAAG
AGGGCCTGGATGAGAACGCTCAGGCATCCCAAAGCCCCAGCGGCAGTGGA
GTTGGGGGCAGAAGGGATGAGCTGGCAGAGGGTGCCCCTTCTGAGGCCAT
GCTGAGACTCCTGCAGAGCGCTTTCAGCAAAAACTCACCCTCAAAGCAAT
CACCAAAGAAGCCCCCAAGTGCGAAGCCCAACATCCCTTATGAAAACTTC
TATGAAGCCCTGGAAAGGCTGAACAAACCCTCCCAGCTTAAAGACTCTGA
GGACAGTCTGTATAACGACTATGTCGATGGCTTCTACAACACGAAACCTT
ACAAGCACAGGGACGACCGGCTGCTCCAAGCTCTGGTGGACCTTCTGAGG
GAGGAAAACTAA


>BT11120-RB
ATGGGGCGAAGAGCCTGGACTCTGCAGTGTACTGCTTTCTCTCTGTTTTG
CGCTTGGTGTGCAATGAACAGTGTAAAAGCGAAGAGGCAGTTTGTGAATG
AATGGGCGGCGGAGATCCCCGGGGGACCTGAGGCAGCCTCGGCGATAGCC
CAGGAGCTAGGCTATGACCTTTTGGGTCAGATTGGATCACTTGAAAATCA
CTACTTATTCAAACACAGAAACCATCCTCGGAGGTCTCGAAGGAGTGCCC
TTCACATCACTAAGAGATTGTCTGATGATGATCGTGTGATATGGGCGGAA
CAACAGTATGAAAAAGAAAGAAGTAAACGTTCAGTTCTAAGAGACTCAGC
ACTAGATCTCTTCAATGATCCGATGTGGAATCAGCAGTGGTACTTGCAAG
ATACAAGGATGACTGCAACCCTGCCCAAGCTGGATCTCCATGTGATACCT
GTTTGGCAAAAAGGCATCACAGGCAAAGGTGTTGTTATCACTGTATTGGA
TGATGGCTTGGAGTGGAATCACACAGACATCTATGCCAACTATGATCCGG
AGGCCAGCTATGATTTTAACGATAATGACCATGATCCATTTCCCCGATAT
GATCCCACAAATGAGAACAAACATGGAACCAGATGTGCAGGAGAAATTGC
GATGCAAGCAAATAATCACAAGTGTGGGGTCGGAGTTGCATACAATTCCA
AAGTTGGAGGCATAAGAATGCTAGATGGCATTGTGACCGATGCTATTGAA
GCCAGCTCAATTGGATTTAATCCTGGGCATGTGGATATTTACAGCGCAAG
CTGGGGCCCTAACGATGACGGGAAAACTGTGGAGGGGCCTGGTCGACTGG
CCCAGAAGGCTTTTGAATATGGTGTCAAACAGGGCAGACAAGGAAAGGGC
TCTATCTTCGTCTGGGCCTCCGGGAACGGGGGGCGTCAGGGAGACAACTG
TGACTGCGACGGGTACACGGACAGCATCTATACCATCTCCATCAGCAGTG
CCTCGCAGCAAGGCCTATCCCCCTGGTACGCAGAGAAGTGCTCCTCCACG
CTGGCCACCTCCTACAGCAGTGGGGACTACACTGACCAGCGAATCACGAG
CGCTGACCTGCACAACGACTGCACGGAGACCCATACGGGCACCTCAGCCT
CTGCACCCCTGGCCGCTGGCATCTTCGCTCTAGCCCTGGAAGCAAATCCC
AATCTCACCTGGCGAGATATGCAGCACTTGGTTGTATGGACCTCTGAGTA
TGACCCACTGGCCAATAACCCTGGATGGAAAAAGAACGGAGCAGGCTTGA
TGGTGAACAGTCGATTTGGATTCGGGCTGCTAAATGCCAAAGCTCTGGTG
GATTTGGCTGATCCCAGCACCTGGAGCAGTGTGCCTGAGAAGAAGGAATG
TGTTGTCAAGGACAATGACTTTGAGCCCAGAGCCCTGAAAGCTAATGGAG
AAGTCATCATAGAAATTCCAACAAGAGCTTGTGAAGGTCAAGAAAATGCT
ATCAAGTCACTGGAACATGTGCAATTTGAAGCAACAATTGAATATTCCCG
CAGAGGAGACCTTCATGTCACCCTCACTTCGGCCGCTGGAACCAGCACCG
TACTGTTGGCTGAAAGAGAGCGGGACACCTCTCCCAATGGCTTTAAGAAC
TGGGACTTCATGTCTGTTCACACGTGGGGAGAGAACCCAATAGGCACTTG
GACTTTGCGAATTGCAGACATGTCTGGAAGACTGCAAAACGAAGGAAGAA
TCGTGACCTGGAAGCTGATCCTGCACGGGACCTCTTCCCAGCCAGAGCAC
ATGAAACAGCCCCGGGTGTACACGTCTTACAACACCGTGCAGAACGACCG
AAGAGGCGTGGAGAAGGTGGTGGACTCCGGGGAGGAGCAGCCTACACAAG
AGGGCCTGGATGAGAACGCTCAGGCATCCCAAAGCCCCAGCGGCAGTGGA
GTTGGGGGCAGAAGGGATGAGCTGGCAGAGGGTGCCCCTTCTGAGGCCAT
GCTGAGACTCCTGCAGAGCGCTTTCAGCAAAAACTCACCCTCAAAGCAAT
CACCAAAGAAGCCCCCAAGTGCGAAGCCCAACATCCCTTATGAAAACTTC
TATGAAGCCCTGGAAAGGCTGAACAAACCCTCCCAGCTTAAAGACTCTGA
GGACAGTCTGTATAACGACTATGTCGATGGCTTCTACAACACGAAACCTT
ACAAGCACAGGGACGACCGGCTGCTCCAAGCTCTGGTGGACCTTCTGAGG
GAGGAAAAC



Protein Sequences

>BT11120-PA
MGRRAWTLQCTAFSLFCAWCAMNSVKAKRQFVNEWAAEIPGGPEAASAIA
QELGYDLLGQIGSLENHYLFKHRNHPRRSRRSALHITKRLSDDDRVIWAE
QQYEKERSKRSVLRDSALDLFNDPMWNQQWYLQDTRMTATLPKLDLHVIP
VWQKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDHDPFPRY
DPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLDGIVTDAIE
ASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSST
LATSYSSGDYTDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANP
NLTWRDMQHLVVWTSEYDPLANNPGWKKNGAGLMVNSRFGFGLLNAKALV
DLADPSTWSSVPEKKECVVKDNDFEPRALKANGEVIIEIPTRACEGQENA
IKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERERDTSPNGFKN
WDFMSVHTWGENPIGTWTLRIADMSGRLQNEGRIVTWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKVVDSGEEQPTQEGLDENAQASQSPSGSG
VGGRRDELAEGAPSEAMLRLLQSAFSKNSPSKQSPKKPPSAKPNIPYENF
YEALERLNKPSQLKDSEDSLYNDYVDGFYNTKPYKHRDDRLLQALVDLLR
EEN


>BT11120-PB
MGRRAWTLQCTAFSLFCAWCAMNSVKAKRQFVNEWAAEIPGGPEAASAIA
QELGYDLLGQIGSLENHYLFKHRNHPRRSRRSALHITKRLSDDDRVIWAE
QQYEKERSKRSVLRDSALDLFNDPMWNQQWYLQDTRMTATLPKLDLHVIP
VWQKGITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDHDPFPRY
DPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRMLDGIVTDAIE
ASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSST
LATSYSSGDYTDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANP
NLTWRDMQHLVVWTSEYDPLANNPGWKKNGAGLMVNSRFGFGLLNAKALV
DLADPSTWSSVPEKKECVVKDNDFEPRALKANGEVIIEIPTRACEGQENA
IKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERERDTSPNGFKN
WDFMSVHTWGENPIGTWTLRIADMSGRLQNEGRIVTWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKVVDSGEEQPTQEGLDENAQASQSPSGSG
VGGRRDELAEGAPSEAMLRLLQSAFSKNSPSKQSPKKPPSAKPNIPYENF
YEALERLNKPSQLKDSEDSLYNDYVDGFYNTKPYKHRDDRLLQALVDLLR
EEN




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.