BT11335

Link to gene wiki page

[-] General Information


Transcripts for BT11335 BT11335-RA  

NCBI Gene Symbol: SETD8

Description:
SET domain containing (lysine methyltransferase) 8

Overlapping Locus Information:

NCBI: 532622

Genomic Location: Chr17.30   643918 .. 654969    [-]

GO Annotations for BT11335

Biological Process
GO:0007049 IEA  cell cycle
GO:0007067 IEA  mitosis
GO:0016481 IEA  negative regulation of transcription
GO:0016568 IEA  chromatin modification
GO:0051301 IEA  cell division
Molecular Function
GO:0003714 IEA  transcription corepressor activity
GO:0005515 IEA  protein binding
GO:0008168 IEA  methyltransferase activity
GO:0016740 IEA  transferase activity
GO:0018024 IEA  histone-lysine N-methyltransferase activity
Cellular Component
GO:0005634 IEA  nucleus
GO:0005694 IEA  chromosome

[-] Transcripts for BT11335

BT11335-RA

Gene Model Source: RefSeq 
OGSv1 ID: GLEAN_17469 

Sequences:

Transcript: BT11335-RA View Text HTML XML
Protein: BT11335-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_001046330.1
NCBI Protein: NP_001039795.1

User Submitted Information:

Submitter Name: Chris Verschoor
Submitter ID: cverscho
Temporary ID: Btgn_tempid_2347-PA

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT11335-RA
GAGAATGTATTTACCGGGCAATCAAAGATCTATACCTACATGAGCCCGAA
CAAATGCTCTGGAATGCGTTCCCCCCTTCAGGAAGAGAACTCAGTTGCAC
AATACGAAGTCAAATGCCAGGGGAAGCCATTAGCCGGAATCTACAGGAAA
CGCGACGAGAAAAGAAACTCTGGGAATGCAATACGAAGCTCCATGAAGGC
CGAGGAACAGAAGATCAAAGACGCCAGGAGAGGTCCCCTGGCACCTTTTC
CAAACCAAAAATCTGAAGCTGCAGAACCTCCCAAAACCCCAACCTCGTCT
TGTGATACTCCCAATGCAGCCGCTGCCAAGCAGGGCCTGAAAAAGCCTGT
GAGGGGCAAACAGGCCCCCAGGAAAAAAGCTCAAGGAAAAACACAGCAGA
ATCGCAAGCTCACAGATTTCTACCCTGTGCGAAGGAGCTCCAGGAAGAGC
AAGGCTGAGCTGCAGTCTGAAGAAAGGAAAAGAATAGATGAGTTGATTGA
AAGCGGGAAGGAAGAAGGAATGAAGATCGACCTCATCGACGGCAAAGGCA
GGGGCGTCATCGCCACCAAGCAGTTCTCCCGGGGTGAGTTTGTGGTGGAA
TACCACGGGGACCTCATCGAGATCACCGACGCCAAGAAGCGGGAGGCTCT
GTACGCACAAGACCCCTCCACGGGCTGCTACATGTACTATTTTCAGTATC
TGAGCAAAACCTACTGCGTGGATGCAACCCGAGAGACAAATCGCCTGGGA
AGACTGATCAATCACAGTAAATGTGGGAACTGCCAAACCAAACTGCACGA
CATCGACGGCGTGCCTCACCTCATCCTCATCGCCTCCCGTGACATCGAGG
CCGGGGAGGAGCTTCTGTATGACTATGGGGACCGCAGCCGGGCTTCCATT
GAAGCCTACCCCTGGCTGAAGCAT



Protein Sequences

>BT11335-PA
ENVFTGQSKIYTYMSPNKCSGMRSPLQEENSVAQYEVKCQGKPLAGIYRK
RDEKRNSGNAIRSSMKAEEQKIKDARRGPLAPFPNQKSEAAEPPKTPTSS
CDTPNAAAAKQGLKKPVRGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKS
KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGEFVVE
YHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLG
RLINHSKCGNCQTKLHDIDGVPHLILIASRDIEAGEELLYDYGDRSRASI
EAYPWLKH




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.