BT11716

Link to gene wiki page

[-] General Information


Transcripts for BT11716 BT11716-RA   BT11716-RB  

NCBI Gene Symbol: IL21

Description:
interleukin 21

Overlapping Locus Information:

NCBI: 378475

Genomic Location: Chr17.18   152021 .. 159153    [-]

GO Annotations for BT11716

Biological Process
GO:0002729 IEA  positive regulation of natural killer cell cytokine production
GO:0006955 IEA  immune response
GO:0032733 IEA  positive regulation of interleukin-10 production
GO:0032825 IEA  positive regulation of natural killer cell differentiation
GO:0042102 IEA  positive regulation of T cell proliferation
GO:0045078 IEA  positive regulation of interferon-gamma biosynthetic process
GO:0045954 IEA  positive regulation of natural killer cell mediated cytotoxicity
GO:0048469 IEA  cell maturation
Molecular Function
GO:0005125 IEA  cytokine activity
GO:0005134 IEA  interleukin-2 receptor binding
Cellular Component
GO:0005576 IEA  extracellular region
GO:0005615 IEA  extracellular space

[-] Transcripts for BT11716

BT11716-RA

Gene Model Source: Manual 
OGSv1 ID: GLEAN_08315 

Sequences:

Transcript: BT11716-RA View Text HTML XML
Protein: BT11716-PA View Text HTML XML

User Submitted Information:

Submitter Name: Aaron Ingham
Submitter ID: aaron.ingham
Temporary ID: Btgn_tempid_1160-PA

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

BT11716-RB

Gene Model Source: RefSeq 

Sequences:

Transcript: BT11716-RB View Text HTML XML
Protein: BT11716-PB View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_198832.1
NCBI Protein: NP_942129.1
Ensembl Transcript: ENSBTAT00000016413
Ensembl Protein: ENSBTAP00000016413

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT11716-RA
ATGGAGAGAATAGTCATTTGCCTGATGGTCATCTTCTCTGGGACAGTGGC
CCATAAGTCAAGCTCCCAAGGGCAAGATCGCCTCTTTATTAGACTGCGTC
AACTTATAGACATTGTTGATCAGCTGAAAAACTATGTGAATGACTTGGAT
CCTGAATTTCTGCCAGCTCCAGAAGATGTAAAGAGACACTGTGAGCGGTC
AGCTTTTTCATGTTTTCAGAAGGTTCAACTAAAGTCAGCAAATAATGGAG
ACAACGAAAAGATAATCAACATATTAACTAAACAGCTGAAGAGGAAACTA
CCTGCCACAAATACAGGGAGAAGACAGAAACATGAAGTAACATGTCCTTC
TTGTGATTCTTATGAGAAAAAACCACCCAAGGAATACCTAGAAAGACTGA
AATCACTCATCCAAAAGATGATTCATCAGCATCTGTCC


>BT11716-RB
CCTGGCAACATGGAGAGAATAGTCATTTGCCTGATGGTCATCTTCTCTGG
GACAGTGGCCCATAAGTCAAGCTCCCAAGGGCAAGATCGCCTCTTTATTA
GACTGCGTCAACTTATAGACATTGTTGATCAGCTGAAAAACTATGTGAAT
GACTTGGATCCTGAATTTCTGCCAGCTCCAGAAGATGTAAAGAGACACTG
TGAGCGGTCAGCTTTTTCATGTTTTCAGAAGGTTCAACTAAAGTCAGCAA
ATAATGGAGACAACGAAAAGATAATCAACATATTAACTAAACAGCTGAAG
AGGAAACTACCTGCCACAAATACAGGGAGAAGACAGAAACATGAAGTAAC
ATGTCCTTCTTGTGATTCTTATGAGAAAAAACCACCCAAGGAATACCTAG
AAAGACTGAAATCACTCATCCAAAAGATGATTCATCAGCATCTGTCC



Protein Sequences

>BT11716-PA
MERIVICLMVIFSGTVAHKSSSQGQDRLFIRLRQLIDIVDQLKNYVNDLD
PEFLPAPEDVKRHCERSAFSCFQKVQLKSANNGDNEKIINILTKQLKRKL
PATNTGRRQKHEVTCPSCDSYEKKPPKEYLERLKSLIQKMIHQHLS


>BT11716-PB
PGNMERIVICLMVIFSGTVAHKSSSQGQDRLFIRLRQLIDIVDQLKNYVN
DLDPEFLPAPEDVKRHCERSAFSCFQKVQLKSANNGDNEKIINILTKQLK
RKLPATNTGRRQKHEVTCPSCDSYEKKPPKEYLERLKSLIQKMIHQHLS




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.