BT11809

Link to gene wiki page

[-] General Information


Transcripts for BT11809 BT11809-RA  

NCBI Gene Symbol: CYP21A2

Description:
cytochrome P450, family 21, subfamily A, polypeptide 2

Overlapping Locus Information:

NCBI: 282425

Genomic Location: Chr23.26   108015 .. 111676    [-]

GO Annotations for BT11809

Biological Process
GO:0055114 IEA  oxidation reduction
Molecular Function
GO:0004497 IEA  monooxygenase activity
GO:0009055 IEA  electron carrier activity
GO:0020037 IEA  heme binding

[-] Transcripts for BT11809

BT11809-RA

Gene Model Source: RefSeq 
OGSv1 ID: GLEAN_00717 

Sequences:

Transcript: BT11809-RA View Text HTML XML
Protein: BT11809-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_174639.1
NCBI Protein: NP_777064.1
Ensembl Transcript: ENSBTAT00000007353
Ensembl Protein: ENSBTAP00000007353

User Submitted Information:

Submitter Name: Nathan Poslusny,Hari Nandakumar
Submitter ID: nathan.poslusny,groupleader
Temporary ID: Btgn_tempid_116-PB,Btgn_tempid_116-PA

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT11809-RA
ATGGTCCTCGCAGGGCTGCTGCTGCTGCTCACCCTGCTAGCTGGCGCTCA
CCTGCTATGGGGCCGGTGGAAGCTCAGAAACCTCCACCTCCCACCTCTGG
TCCCCGGCTTCCTGCACCTGCTGCAGCCCAACCTCCCCATCCATCTGCTG
AGCCTGACTCAGAAACTCGGGCCTGTCTACAGGCTTCGCCTTGGGCTGCA
AGAGGTGGTGGTGCTGAACTCCAAGAGGACCATTGAGGAGGCTATGATCA
GGAAGTGGGTGGACTTTGCCGGCAGACCCCAGATACCATCCTACAAGTTG
GTGTCTCAGCGCTGCCAGGACATCTCTCTGGGGGACTACTCTCTGCTCTG
GAAGGCCCACAAGAAACTCACCCGCTCAGCCTTGCTGCTGGGCACCCGCA
GCTCCATGGAGCCCTGGGTGGACCAGCTGACCCAGGAGTTCTGCGAGCGC
ATGAGAGTCCAGGCCGGTGCCCCCGTGACCATCCAGAAGGAATTCTCTCT
GCTTACCTGCAGCATCATCTGTTACCTCACTTTTGGAAACAAGGAGGACA
CCTTAGTACATGCCTTTCACGACTGTGTTCAGGACTTGATGAAGACCTGG
GACCACTGGTCCATCCAGATTTTGGACATGGTTCCTTTTCTCAGGTTCTT
CCCCAACCCTGGGCTCTGGAGGCTGAAGCAGGCCATAGAGAACAGGGACC
ACATGGTGGAGAAGCAGCTGACGCGCCACAAGGAGAGCATGGTGGCCGGC
CAGTGGAGGGATATGACGGACTACATGCTCCAGGGGGTAGGGAGGCAAAG
AGTAGAAGAGGGCCCGGGACAGCTCCTGGAAGGACACGTGCACATGTCTG
TGGTGGACCTTTTCATCGGGGGCACTGAAACCACGGCGAGCACCCTCTCC
TGGGCTGTGGCGTTCCTACTTCACCACCCCGAGATTCAGCGCCGCCTTCA
GGAGGAGTTGGATCGCGAGCTGGGCCCCGGAGCCTCATGCTCCCGAGTCA
CTTACAAGGACCGCGCTCGGCTGCCTCTGCTCAACGCCACCATCGCGGAG
GTGCTGCGCCTGCGGCCGGTCGTGCCCCTGGCCTTGCCTCACCGCACCAC
GCGGCCTAGCAGCATCTTCGGCTACGACATCCCTGAGGGCATGGTCGTTA
TCCCCAACCTCCAAGGTGCCCACCTGGACGAGACCGTCTGGGAGCAGCCG
CACGAGTTCCGGCCGGACCGCTTCCTGGAGCCGGGCGCGAACCCCAGCGC
GCTGGCATTTGGCTGCGGGGCGCGCGTGTGCCTGGGCGAGTCGCTGGCGC
GCCTGGAGCTCTTCGTGGTGCTCCTGCGACTGCTGCAGGCCTTCACGCTG
CTGCCGCCGCCCGTGGGCGCCCTGCCGTCGCTGCAGCCGGATCCCTACTG
CGGTGTCAACCTCAAGGTCCAGCCTTTCCAGGTGCGGCTGCAGCCCCGGG
GGGTGGAGGCCGGGGCCTGGGAGAGCGCCAGTGCCCAG



Protein Sequences

>BT11809-PA
MVLAGLLLLLTLLAGAHLLWGRWKLRNLHLPPLVPGFLHLLQPNLPIHLL
SLTQKLGPVYRLRLGLQEVVVLNSKRTIEEAMIRKWVDFAGRPQIPSYKL
VSQRCQDISLGDYSLLWKAHKKLTRSALLLGTRSSMEPWVDQLTQEFCER
MRVQAGAPVTIQKEFSLLTCSIICYLTFGNKEDTLVHAFHDCVQDLMKTW
DHWSIQILDMVPFLRFFPNPGLWRLKQAIENRDHMVEKQLTRHKESMVAG
QWRDMTDYMLQGVGRQRVEEGPGQLLEGHVHMSVVDLFIGGTETTASTLS
WAVAFLLHHPEIQRRLQEELDRELGPGASCSRVTYKDRARLPLLNATIAE
VLRLRPVVPLALPHRTTRPSSIFGYDIPEGMVVIPNLQGAHLDETVWEQP
HEFRPDRFLEPGANPSALAFGCGARVCLGESLARLELFVVLLRLLQAFTL
LPPPVGALPSLQPDPYCGVNLKVQPFQVRLQPRGVEAGAWESASAQ




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.