BT11819

Link to gene wiki page

[-] General Information


Transcripts for BT11819 BT11819-RA   BT11819-RB  

NCBI Gene Symbol: PTGS2

Description:
prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)

Overlapping Locus Information:

NCBI: 282023

Genomic Location: Chr16.49   1592341 .. 1599965    [-]

GO Annotations for BT11819

Biological Process
GO:0001516 IEA  prostaglandin biosynthetic process
GO:0006633 IEA  fatty acid biosynthetic process
GO:0006979 IEA  response to oxidative stress
GO:0008217 IEA  regulation of blood pressure
GO:0042127 IEA  regulation of cell proliferation
GO:0042640 IEA  anagen
GO:0055114 IEA  oxidation reduction
Molecular Function
GO:0004601 IEA  peroxidase activity
GO:0004666 IEA  prostaglandin-endoperoxide synthase activity
GO:0016491 IEA  oxidoreductase activity
GO:0016702 IEA  oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0020037 IEA  heme binding
GO:0046872 IEA  metal ion binding
Cellular Component
GO:0005737 IEA  cytoplasm
GO:0005783 IEA  endoplasmic reticulum
GO:0005792 IEA  microsome
GO:0016020 IEA  membrane
GO:0019898 IEA  extrinsic to membrane

[-] Transcripts for BT11819

BT11819-RA

Gene Model Source: Manual 
OGSv1 ID: GLEAN_10058 

Sequences:

Transcript: BT11819-RA View Text HTML XML
Protein: BT11819-PA View Text HTML XML

User Submitted Information:

Submitter Name: Natalia Martins
Submitter ID: natalia
Temporary ID: Btgn_tempid_2564-PA

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

BT11819-RB

Gene Model Source: RefSeq 
OGSv1 ID: GLEAN_10058 

Sequences:

Transcript: BT11819-RB View Text HTML XML
Protein: BT11819-PB View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_174445.2
NCBI Protein: NP_776870.1
Ensembl Transcript: ENSBTAT00000018774
Ensembl Protein: ENSBTAP00000018774

User Submitted Information:

Submitter Name: Chris Verschoor
Submitter ID: cverscho
Temporary ID: Btgn_tempid_2564-PB

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT11819-RA
AACGTCAGAGGACGCCCCGGAACTCCGCACCGCGCCTCCTCCGGCCCCGC
AGCTCCGATCCGCGCACCTCCACGCCTCCGCCGGCCCCGCGCCCCGCCCG
CAGCCGAGATGCTCGCCCGGGCCCTGCTGCTCTGCGCTGCCGTGGCGCTC
AGCGGTGCAGCAAATCCTTGCTGTTCCCATCCATGCCAGAATCGAGGTGT
ATGTATGAGTGTAGGATTTGACCAGTATAAATGTGACTGTACCCGAACAG
GATTCTACGGTGAAAACTGTACCACACCCGAATTTCTGACAAGAATAAAA
TTACTCCTGAAACCCACTCCCAACACAGTGCACTACATACTTACCCACTT
CAAAGGAGTCTGGAACATTGTCAATAAGATCTCCTTCCTGCGAAATATGA
TTATGAGATATGTGTTGACGTCGAGATCACATTTGATTGAGAGTCCACCA
ACTTATAATGTGCACTACAGCTATAAAAGCTGGGAAGCCTTTTCTAACCT
GTCTTATTATACCAGAGCTCTTCCTCCTGTGCCTGATGACTGCCCAACAC
CCATGGGTGTGAAAGGGAGGAAAGAGCTTCCTGATTCAAAAGAAGTTGTG
AAAAAAGTACTTCTAAGAAGAAAGTTCATTCCTGATCCCCAGGGCACAAA
TCTGATGTTTGCATTCTTTGCCCAGCACTTCACCCATCAATTTTTCAAGA
CAGATTTTGAACGAGGACCAGCTTTCACTAAGGGAAAGAACCATGGGGTG
GACTTAAGTCACATTTATGGTGAATCTTTAGAGAGACAGCATAAGCTGCG
CCTTTTCAAGGATGGAAAAATGAAATATCAGATGATTAATGGAGAGATGT
ATCCTCCCACAGTCAAAGATACTCAGGTCGAAATGATCTACCCGCCTCAT
GTTCCTGAACACTTGAAGTTTGCTGTGGGCCAGGAAGTCTTTGGTCTGGT
GCCTGGTCTGATGATGTATGCCACCATTTGGCTACGGGAACACAACAGAG
TGTGTGATGTGCTTAAACAAGAGCATCCAGAATGGGGCGATGAGCAGTTG
TTCCAGACAAGCAGGCTAATCCTGATAGGAGAAACTATTAAGATTGTGAT
TGAAGACTACGTACAGCACTTGAGTGGCTATCACTTCAAACTGAAGTTTG
ACCCAGAGCTGCTTTTCAACCAACAGTTCCAGTACCAGAACCGTATTGCT
GCTGAGTTTAACACGCTCTACCACTGGCATCCCCTTCTGCCTGACGTCTT
TCAGATTGATGGTCAGGAGTACAACTATCAGCAGTTTATCTATAACAACT
CTGTCTTACTGGAACATGGTCTCACTCAGTTTGTTGAATCATTCACCAGG
CAAAGGGCTGGCAGGGTCGCTGGCGGTAGGAATCTTCCAGTCGCAGTAGA
GAAAGTATCAAAGGCTTCAATTGACCAGAGCAGAGAGATGAAATACCAGT
CTTTTAATGAGTATCGCAAACGTTTTCTGCTGAAGCCCTATGAATCATTT
GAGGAACTTACAGGAGAGAAGGAAATGGCTGCAGAGTTAGAAGCGCTCTA
TGGAGACATAGATGCCATGGAGTTTTATCCCGCCCTTCTGGTAGAGAAGC
CCCGTCCAGACGCCATCTTTGGGGAGACCATGGTAGAAGCTGGAGCACCA
TTCTCCCTGAAAGGACTTATGGGTAATCCTATATGCTCTCCCGAGTACTG
GAAGCCTAGCACTTTCGGTGGAGAAGTAGGTTTTAAAATCATCAACACTG
CCTCAATTCAGTCTCTCATCTGCAGTAACGTGAAAGGCTGTCCCTTTACC
TCATTCAGTGTTCAAGATACGCACCTCACCAAAACGGTCACCATTAATGC
AAGCTCTTCCCACTCTGGACTAGATGATATCAACCCCACAGTCCTACTAA
AGGAACGTTCAACCGAACTG


>BT11819-RB
ATGCTCGCCCGGGCCCTGCTGCTCTGCGCTGCCGTGGCGCTCAGCGGTGC
AGCAAATCCTTGCTGTTCCCATCCATGCCAGAATCGAGGTGTATGTATGA
GTGTAGGATTTGACCAGTATAAATGTGACTGTACCCGAACAGGATTCTAC
GGTGAAAACTGTACCACACCCGAATTTCTGACAAGAATAAAATTACTCCT
GAAACCCACTCCCAACACAGTGCACTACATACTTACCCACTTCAAAGGAG
TCTGGAACATTGTCAATAAGATCTCCTTCCTGCGAAATATGATTATGAGA
TATGTGTTGACGTCGAGATCACATTTGATTGAGAGTCCACCAACTTATAA
TGTGCACTACAGCTATAAAAGCTGGGAAGCCTTTTCTAACCTGTCTTATT
ATACCAGAGCTCTTCCTCCTGTGCCTGATGACTGCCCAACACCCATGGGT
GTGAAAGGGAGGAAAGAGCTTCCTGATTCAAAAGAAGTTGTGAAAAAAGT
ACTTCTAAGAAGAAAGTTCATTCCTGATCCCCAGGGCACAAATCTGATGT
TTGCATTCTTTGCCCAGCACTTCACCCATCAATTTTTCAAGACAGATTTT
GAACGAGGACCAGCTTTCACTAAGGGAAAGAACCATGGGGTGGACTTAAG
TCACATTTATGGTGAATCTTTAGAGAGACAGCATAAGCTGCGCCTTTTCA
AGGATGGAAAAATGAAATATCAGATGATTAATGGAGAGATGTATCCTCCC
ACAGTCAAAGATACTCAGGTCGAAATGATCTACCCGCCTCATGTTCCTGA
ACACTTGAAGTTTGCTGTGGGCCAGGAAGTCTTTGGTCTGGTGCCTGGTC
TGATGATGTATGCCACCATTTGGCTACGGGAACACAACAGAGTGTGTGAT
GTGCTTAAACAAGAGCATCCAGAATGGGGCGATGAGCAGTTGTTCCAGAC
AAGCAGGCTAATCCTGATAGGAGAAACTATTAAGATTGTGATTGAAGACT
ACGTACAGCACTTGAGTGGCTATCACTTCAAACTGAAGTTTGACCCAGAG
CTGCTTTTCAACCAACAGTTCCAGTACCAGAACCGTATTGCTGCTGAGTT
TAACACGCTCTACCACTGGCATCCCCTTCTGCCTGACGTCTTTCAGATTG
ATGGTCAGGAGTACAACTATCAGCAGTTTATCTATAACAACTCTGTCTTA
CTGGAACATGGTCTCACTCAGTTTGTTGAATCATTCACCAGGCAAAGGGC
TGGCAGGGTCGCTGGCGGTAGGAATCTTCCAGTCGCAGTAGAGAAAGTAT
CAAAGGCTTCAATTGACCAGAGCAGAGAGATGAAATACCAGTCTTTTAAT
GAGTATCGCAAACGTTTTCTGCTGAAGCCCTATGAATCATTTGAGGAACT
TACAGGAGAGAAGGAAATGGCTGCAGAGTTAGAAGCGCTCTATGGAGACA
TAGATGCCATGGAGTTTTATCCCGCCCTTCTGGTAGAGAAGCCCCGTCCA
GACGCCATCTTTGGGGAGACCATGGTAGAAGCTGGAGCACCATTCTCCCT
GAAAGGACTTATGGGTAATCCTATATGCTCTCCCGAGTACTGGAAGCCTA
GCACTTTCGGTGGAGAAGTAGGTTTTAAAATCATCAACACTGCCTCAATT
CAGTCTCTCATCTGCAGTAACGTGAAAGGCTGTCCCTTTACCTCATTCAG
TGTTCAAGATACGCACCTCACCAAAACGGTCACCATTAATGCAAGCTCTT
CCCACTCTGGACTAGATGATATCAACCCCACAGTCCTACTAAAGGAACGT
TCAACCGAACTG



Protein Sequences

>BT11819-PA
NVRGRPGTPHRASSGPAAPIRAPPRLRRPRAPPAAEMLARALLLCAAVAL
SGAANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCTTPEFLTRIK
LLLKPTPNTVHYILTHFKGVWNIVNKISFLRNMIMRYVLTSRSHLIESPP
TYNVHYSYKSWEAFSNLSYYTRALPPVPDDCPTPMGVKGRKELPDSKEVV
KKVLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTDFERGPAFTKGKNHGV
DLSHIYGESLERQHKLRLFKDGKMKYQMINGEMYPPTVKDTQVEMIYPPH
VPEHLKFAVGQEVFGLVPGLMMYATIWLREHNRVCDVLKQEHPEWGDEQL
FQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIA
AEFNTLYHWHPLLPDVFQIDGQEYNYQQFIYNNSVLLEHGLTQFVESFTR
QRAGRVAGGRNLPVAVEKVSKASIDQSREMKYQSFNEYRKRFLLKPYESF
EELTGEKEMAAELEALYGDIDAMEFYPALLVEKPRPDAIFGETMVEAGAP
FSLKGLMGNPICSPEYWKPSTFGGEVGFKIINTASIQSLICSNVKGCPFT
SFSVQDTHLTKTVTINASSSHSGLDDINPTVLLKERSTEL


>BT11819-PB
MLARALLLCAAVALSGAANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFY
GENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNKISFLRNMIMR
YVLTSRSHLIESPPTYNVHYSYKSWEAFSNLSYYTRALPPVPDDCPTPMG
VKGRKELPDSKEVVKKVLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTDF
ERGPAFTKGKNHGVDLSHIYGESLERQHKLRLFKDGKMKYQMINGEMYPP
TVKDTQVEMIYPPHVPEHLKFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPE
LLFNQQFQYQNRIAAEFNTLYHWHPLLPDVFQIDGQEYNYQQFIYNNSVL
LEHGLTQFVESFTRQRAGRVAGGRNLPVAVEKVSKASIDQSREMKYQSFN
EYRKRFLLKPYESFEELTGEKEMAAELEALYGDIDAMEFYPALLVEKPRP
DAIFGETMVEAGAPFSLKGLMGNPICSPEYWKPSTFGGEVGFKIINTASI
QSLICSNVKGCPFTSFSVQDTHLTKTVTINASSSHSGLDDINPTVLLKER
STEL




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.