BT11892

Link to gene wiki page

[-] General Information


Transcripts for BT11892 BT11892-RA  

NCBI Gene Symbol: MAPK3

Ensembl Gene Symbol: MAPK3

Description:
mitogen-activated protein kinase 3

Overlapping Locus Information:

NCBI: 531391
Ensembl: ENSBTAG00000016156

Genomic Location: Chr25.36   881229 .. 886480    [+]

[-] Transcripts for BT11892

BT11892-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT11892-RA View Text HTML XML
Protein: BT11892-PA View Text HTML XML

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT11892-RA
ATGGCGGCGGCGGCGGCGGCTCAGGGGGGCGGGGGCGGGGAGCCCCGGGG
AACTGATGGGGTCGGCCCGGGGGTCCCAGGGGAGGTAGAGATAGTAAAGG
GGCAGCCGTTCGACGTGGGCCCGCGCTACACGCAGCTGCAGTACATCGGC
GAGGGCGCGTACGGCATGGTCAGCTCAGCTTACGACCACGTGCGCAAGAC
TCGAGTGGCCATCAAGAAAATCAGCCCCTTTGAGCATCAGACCTACTGCC
AGCGCACATTGCGAGAGATTCAGATTCTGCTGCGCTTCCGCCATGAGAAC
GTCATTGGCATCCGAGACATTCTGCGGGCACCCACCCTGGAAGCCATGAG
GGATGTCTACATCGTACAGGACCTGATGGAGACAGACCTGTACAAATTGC
TCAAAAGCCAGCAGCTGAGCAACGACCATGTATGCTACTTCCTGTACCAG
ATCCTGCGGGGCCTGAAGTATATCCACTCCGCCAACGTGCTCCACCGGGA
TTTAAAGCCCTCCAACCTGCTCATCAACACCACCTGCGACCTTAAGATCT
GTGATTTCGGTCTTGCCCGGATTGCTGATCCCGAGCATGACCACACTGGC
TTTCTGACGGAATACGTGGCCACACGCTGGTACCGGGCCCCAGAGATCAT
GCTTAACTCCAAGGGCTACACCAAGTCCATCGACATCTGGTCTGTGGGCT
GCATTCTGGCTGAGATGCTCTCCAACCGGCCCATCTTCCCCGGCAAGCAC
TACCTGGACCAGCTCAACCACATTCTGGGTATTCTAGGCTCCCCATCCCA
GGAGGACCTGAATTGTATCATCAACATGAAGGCCCGAAACTACCTACAGT
CTCTGCCCTCCAAGACCAAGGTGGCCTGGGCCAAGCTTTTTCCTAAGTCA
GACCCCAAAGCTCTTGACCTGCTGGACCGGATGTTGACCTTTAACCCCAA
CAAACGGATCACAGTGGAAGAAGCGCTGGCTCACCCCTACCTGGAGCAGT
ACTATGACCCAACGGATGAGCCAGTGGCCGAGGAACCTTTCACCTTCGAC
ATGGAGCTGGATGATCTACCCAAGGAACGACTGAAGGAGCTCATCTTCCA
GGAGACAGCCCGCTTCCAGCCTGGGGTGCTGGAAGCCTCC



Protein Sequences

>BT11892-PA
MAAAAAAQGGGGGEPRGTDGVGPGVPGEVEIVKGQPFDVGPRYTQLQYIG
EGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHEN
VIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHVCYFLYQ
ILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTG
FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKH
YLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DPKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFD
MELDDLPKERLKELIFQETARFQPGVLEAS




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.