BT11997

Link to gene wiki page

[-] General Information


Transcripts for BT11997 BT11997-RA  

NCBI Gene Symbol: IFNG

Description:
interferon, gamma

Overlapping Locus Information:

NCBI: 281237

Genomic Location: Chr5.51   932632 .. 937457    [+]

GO Annotations for BT11997

Biological Process
GO:0000060 IEA  protein import into nucleus, translocation
GO:0001781 IEA  neutrophil apoptosis
GO:0006925 IEA  inflammatory cell apoptosis
GO:0007050 IEA  cell cycle arrest
GO:0009615 IEA  response to virus
GO:0019882 IEA  antigen processing and presentation
GO:0030593 IEA  neutrophil chemotaxis
GO:0030968 IEA  endoplasmic reticulum unfolded protein response
GO:0031642 IEA  negative regulation of myelination
GO:0032735 IEA  positive regulation of interleukin-12 production
GO:0033141 IEA  positive regulation of peptidyl-serine phosphorylation of STAT protein
GO:0034393 IEA  positive regulation of smooth muscle cell apoptosis
GO:0040008 IEA  regulation of growth
GO:0042102 IEA  positive regulation of T cell proliferation
GO:0042511 IEA  positive regulation of tyrosine phosphorylation of Stat1 protein
GO:0042742 IEA  defense response to bacterium
GO:0045080 IEA  positive regulation of chemokine biosynthetic process
GO:0045084 IEA  positive regulation of interleukin-12 biosynthetic process
GO:0045348 IEA  positive regulation of MHC class II biosynthetic process
GO:0045410 IEA  positive regulation of interleukin-6 biosynthetic process
GO:0045429 IEA  positive regulation of nitric oxide biosynthetic process
GO:0045449 IEA  regulation of transcription
GO:0045893 IEA  positive regulation of transcription, DNA-dependent
GO:0048304 IEA  positive regulation of isotype switching to IgG isotypes
GO:0048662 IEA  negative regulation of smooth muscle cell proliferation
GO:0050718 IEA  positive regulation of interleukin-1 beta secretion
GO:0050776 IEA  regulation of immune response
GO:0050796 IEA  regulation of insulin secretion
GO:0051044 IEA  positive regulation of membrane protein ectodomain proteolysis
GO:0051712 IEA  positive regulation of killing of cells of another organism
GO:0060550 IEA  positive regulation of fructose 1,6-bisphosphate 1-phosphatase activity
GO:0060552 IEA  positive regulation of fructose 1,6-bisphosphate metabolic process
GO:0060557 IEA  positive regulation of vitamin D biosynthetic process
GO:0060559 IEA  positive regulation of calcidiol 1-monooxygenase activity
Molecular Function
GO:0005125 IEA  cytokine activity
GO:0005133 IEA  interferon-gamma receptor binding
Cellular Component
GO:0005576 IEA  extracellular region
GO:0005615 IEA  extracellular space

[-] Transcripts for BT11997

BT11997-RA

Gene Model Source: RefSeq 
OGSv1 ID: GLEAN_10120 

Sequences:

Transcript: BT11997-RA View Text HTML XML
Protein: BT11997-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_174086.1
NCBI Protein: NP_776511.1
Ensembl Transcript: ENSBTAT00000016634
Ensembl Protein: ENSBTAP00000016634

User Submitted Information:

Submitter Name: Clare Gill,Roberto Malinverni
Submitter ID: clare-gill,roberto.malinverni
Temporary ID: Btgn_tempid_42-PA,Btgn_tempid_42-PB

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT11997-RA
ATGAAATATACAAGCTATTTCTTAGCTTTACTGCTCTGTGGGCTTTTGGG
TTTTTCTGGTTCTTATGGCCAGGGCCAATTTTTTAGAGAAATAGAAAACT
TAAAGGAGTATTTTAATGCAAGTAGCCCAGATGTAGCTAAGGGTGGGCCT
CTCTTCTCAGAAATTTTGAAGAATTGGAAAGATGAAAGTGACAAAAAAAT
TATTCAGAGCCAAATTGTCTCCTTCTACTTCAAACTCTTTGAAAACCTCA
AAGATAACCAGGTCATTCAAAGGAGCATGGATATCATCAAGCAAGACATG
TTTCAGAAGTTCTTGAATGGCAGCTCTGAGAAACTGGAGGACTTCAAAAA
GCTGATTCAAATTCCGGTGGATGATCTGCAGATCCAGCGCAAAGCCATAA
ATGAACTCATCAAAGTGATGAATGACCTGTCACCAAAATCTAACCTCAGA
AAGCGGAAGAGAAGTCAGAATCTCTTTCGAGGCCGGAGAGCATCAATG



Protein Sequences

>BT11997-PA
MKYTSYFLALLLCGLLGFSGSYGQGQFFREIENLKEYFNASSPDVAKGGP
LFSEILKNWKDESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDM
FQKFLNGSSEKLEDFKKLIQIPVDDLQIQRKAINELIKVMNDLSPKSNLR
KRKRSQNLFRGRRASM




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.