BT12494

Link to gene wiki page

[-] General Information


Transcripts for BT12494 BT12494-RA  

NCBI Gene Symbol: GYS1

Description:
glycogen synthase 1 (muscle)

Overlapping Locus Information:

NCBI: 786335
Ensembl: ENSBTAG00000005646

Genomic Location: Chr18.41   428929 .. 444244    [-]

GO Annotations for BT12494

Biological Process
GO:0005978 IEA  glycogen biosynthetic process
Molecular Function
GO:0004373 IEA  glycogen (starch) synthase activity
GO:0016757 IEA  transferase activity, transferring glycosyl groups

[-] Transcripts for BT12494

BT12494-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT12494-RA View Text HTML XML
Protein: BT12494-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_001101299.1
NCBI Protein: NP_001094769.1
Ensembl Transcript: ENSBTAT00000007423
Ensembl Protein: ENSBTAP00000007423

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT12494-RA
ATGCCTCTAAACCGCACTTTGTCCATGTCCTCCCTGCCAGGACTGGAGGA
CTGGGAGGATGAATTCGACCTGGAGAACACAGTGCTCTTCGAGGTGGCCT
GGGAGGTGGCCAACAAGGTGGGCGGGATCTACACAGTGCTGCAGACGAAG
GCAAAGGTGACGGGGGACGAGTGGGGTGACAACTACTACCTGGTGGGACC
GTACACGGAGCAGGGCGTGAGGACCCAGGTGGAGCTGCTGGAACCCCCGA
CCCCGGCCCTGAAGAGGACGCTGGACTCCATGAACAGCAAGGGCTGCAAG
GTGTACTTCGGGCGCTGGCTGATTGAGGGGGGCCCCCTGGTGGTGCTCCT
CGATGTGGGGGCCTCAGCCTGGGCCCTGGAGCGCTGGAAGGGGGAGCTAT
GGGACACATGCAACATCGGGGTGCCCTGGTACGACCGGGAGGCCAACGAC
GCCGTCCTTTTTGGCTTCCTCACCACCTGGTTCCTGGGTGAGTTCCTGGC
CCAGAGCGAGGAGAAACCACACGTGGTCGCACACTTCCACGAGTGGTTGG
CAGGTGTCGGGCTCTGCCTGTGCCGCGCCCGGCGGCTGCCCGTGGCTACC
ATCTTCACCACCCACGCCACGCTGCTGGGGCGATACCTGTGTGCTGGGGC
TGTGGACTTCTACAACAACCTGGAGAATTTCAACGTGGACAAAGAAGCAG
GTGAGAGGCAAATCTATCACCGCTACTGCATGGAGCGGGCCGCAGCCCAC
TGCGCTCATGTCTTCACTACTGTGTCCCAGATTACCGCCATTGAGGCTCA
GCACCTACTCAAAAGGAAACCAGATATCGTGACCCCCAATGGACTGAATG
TGAAGAAATTCTCTGCCATGCATGAGTTCCAGAACCTCCATGCTCAGAGC
AAGGCTCGAATCCAGGAGTTTGTGCGGGGCCATTTTTATGGGCACCTAGA
CTTCAACTTGGACAAGACCTTGTACTTCTTTATCGCCGGCCGCTATGAGT
TCTCCAACAAGGGGGCTGACGTCTTCCTGGAGGCCTTGGCCCGGCTCAAC
TATCTGCTCAGAGTGAATGGCAGTGAGCAGACGGTGGTCGCCTTCTTCAT
CATGCCGGCTCGGACCAACAATTTCAACGTGGAAACCCTTAAGGGCCAGG
CCGTGCGCAAGCAGCTTTGGGATACGGCCAACACAGTGAAGGAAAAGTTT
GGGAGGAAGCTTTACGAATCCTTGCTGGTGGGGAGCCTCCCAGACATGAA
CAAGATGCTGGACAAGGAGGACTTCACTATGATGAAGAGAGCTATCTTTG
CCACACAGCGGCAATCTTTCCCTCCTGTGTGCACCCACAATATGCTGGAT
GACTCCTCAGACCCCATCTTGACAACCATCCGCCGAATCGGCCTCTTTAA
TAGTAGTGCTGACAGAGTCAAGGTGATTTTTCACCCGGAGTTCCTGTCTT
CTACGAGCCCTCTGCTCCCTGTGGACTATGAGGAATTTGTCCGTGGCTGC
CACCTTGGGGTCTTCCCCTCCTACTATGAGCCTTGGGGCTACACACCAGC
TGAATGCACGGTAATGGGTATCCCCAGTGTCTCCACCAACCTCTCCGGAT
TCGGCTGCTTCATGGAGGAACACATCGCAGACCCCTCAGCTTACGGTATC
TACATTCTGGACCGGCGATTCCGCAGTCTGGATGATTCCTGCTCGCAGCT
CACCTCCTTCCTCTACAGTTTCTGCCAGCAGAGCCGAAGGCAGCGCATTA
TCCAGCGGAACCGAACGGAGCGCCTCTCTGACCTTCTGGACTGGAAATAC
CTAGGCCGGTACTACATGTCAGCGCGCCACATGGCGCTGGCCAAGGCCTT
TCCAGAATACTTCACCTACGAGCCTCACGAGGCTGACGCGACCCAGGGCT
ACCGCTACCCACGGCCAGCCTCAGTGCCACCATCACCCTCGCTGTCGCGA
CACTCCAGCCCGCACCAGAGCGAGGATGAGGAGGAACCCCGGGACTTACC
ACCTGATGAAGATGACGAGCGCTACGACGAGGACGAGGAGGCCGCCAAGG
ACCGGCGCAACATCCGCGCCCCCGAGTGGCCACGCCGCGCCTCCTGCACC
TCTTCCACCGGGAGCAAGCGTGGGTCTGTGGACACAGCGCCCTCCAGCTC
AGTCAGCACCCCCAGCGAACCCCTTAGCCCCGCCAGCTCCCTGGGCGAGG
AACGCAAC



Protein Sequences

>BT12494-PA
MPLNRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTK
AKVTGDEWGDNYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCK
VYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREAND
AVLFGFLTTWFLGEFLAQSEEKPHVVAHFHEWLAGVGLCLCRARRLPVAT
IFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYHRYCMERAAAH
CAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLN
YLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKF
GRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLD
DSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGC
HLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPSAYGI
YILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEYFTYEPHEADATQGYRYPRPASVPPSPSLSR
HSSPHQSEDEEEPRDLPPDEDDERYDEDEEAAKDRRNIRAPEWPRRASCT
SSTGSKRGSVDTAPSSSVSTPSEPLSPASSLGEERN




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.