BT14279

Link to gene wiki page

[-] General Information


Transcripts for BT14279 BT14279-RA  

NCBI Gene Symbol: ACE

Description:
angiotensin I converting enzyme

Overlapping Locus Information:

NCBI: 509484

Genomic Location: Chr19.25   4581081 .. 4619616    [+]

GO Annotations for BT14279

Biological Process
GO:0006508 IEA  proteolysis
Molecular Function
GO:0008237 IEA  metallopeptidase activity
GO:0008241 IEA  peptidyl-dipeptidase activity
Cellular Component
GO:0016020 IEA  membrane

[-] Transcripts for BT14279

BT14279-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT14279-RA View Text HTML XML
Protein: BT14279-PA View Text HTML XML

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT14279-RA
ATGCTCCACCGCCTCCCTGAGGCAGACCCCCCCGCCGCCCCAGTTCTTCA
CCCGCAGGGCCCAGTTGAAGGGAGCAGTGCTCCCATCAGCGCCGGTCTCC
AGAAGCCCTTGACCTTCCTCCCCTCCCCGAGCGCCATGGCCTCCCCTGTT
TACCTTCTCGTGCCCTCCTGGTGCCCACAGGAGGAAGCAGCCTTGCTCAG
CCAGGAGTTTTCAGAGGCCTGGGGCCAGAAGGCCAAGGATCTGTTCGACC
CGGTCTGGCAGAACTTTACCGACCCCACGCTGCTGCGCATCATCGGGGCG
GTGCGCACCCTGGGCCCCGCCAACCTGGACCTAGAGAAGCGGCAGAAGTA
CAACTCTCTGCTAAGCAACATGAGCAGGATTTACTCCACTGCCAAGGTCT
GCTTCCCCAACAAGACTGCCCCCTGCTGGTCCCTGGACCCAGAGCTCACC
AATATCCTGGCTTCCTCGCGAAGCTACACCCTGCTGCTGTATGCCTGGGA
GGGCTGGCACAACGCCGCGGGCATCCCACTGAAGCCCCTATACCAGGACT
TCACTGCCCTCAGCAACGAGGCCTACAAGCAGGATGGCTTCTCAGACACA
GGGGCCTACTGGCGCTCCTGGTATGACTCTCCCACCTTCACGGAGGATCT
GGAACGCCTCTACCAGCAGCTGGAGCCCCTCTACCTGAACCTCCATGCCT
ACGTCCGGCGCGCACTGCACCGCCGATATGGGGACAGATACATCAACCTC
AGGGGACCCATCCCCGCTCACCTGCTGGGGAACATGTGGGCCCAGAGCTG
GGAGAACATCTACGACACGGTGGTGCCCTTCCCCGACAAGCCCAATCTTG
ATGTTACCGATGTTATGGTGCAGAAGGGCTGGAACGCCACACACATGTTC
CGGGTGGCGGAGGAGTTCTTCACCTCCCTGGGGCTCTTGCCCATGCCACC
CGAGTTCTGGGCGGAATCCATGCTGGAGAAGCCAAGCGACGGGCGGGAGG
TGGTGTGCCACGCGTCCGCCTGGGACTTCTACAACAGTCCTTCACCCTCA
CCCACATGCTCTCCCTGCCCCAGGATCAAGCAGTGCACGCGGGTCACTAT
GGACCAGCTGTCCACGGTGCACCACGAGATGGGCCACGTGCAGTACTACC
TTCAGTACAAGGGCCAGCACGTCTCCCTGCGCCGAGGCGCCAACCCCGGC
TTCCACGAGGCCATCGGCGATGTGCTGGCCCTCTCCGTCTCCACTCCTGC
ACACCTGCACAAGATCGGCCTGCTGGACCAGGTCACCAATGACACAGAGA
GTGACATCAACTACTTGTTAAAGATGGCACTGGAAAAAATTGCCTTCCTG
CCCTTTGGCTACTTGGTGGACCAGTGGCGTTGGGGGGTCTTTAGTGGGCG
AACCCCCCCTTCCCGCTACAACTATGACTGGTGGTATCTTCGAACCAAGT
ATCAGGGGATCTGTCCTCCGGTTGTCCGAAATGAAACCCACTTTGACGCT
GGAGCCAAGTTTCACGTCCCAAATGTGACCCCGTATATCAGGTACTTCGT
GAGCTTTGTCCTGCAGTTCCAGTTCCACGAAGCGCTGTGCAAGGAGGCAG
GCCACCAAGGCCCCCTGCACCAGTGTGACATCTACCAGTCCACCCAGGCG
GGGGCCAAGCTCCGGGCGCTGCTGCAGGCAGGCTCCTCACGGCCCTGGCA
GGAGGTGCTGAAGGACATGGTTGGCTCAGACAACCTGGACGCTAGGCCGC
TGCTCAGCTACTTCCAGCCGGTCACACAGTGGCTCGAGGAGCAGAACCAG
CAGAACGGCGAGGTCCTGGGCTGGCCAGAGTATCAGTGGCGCCCACCGAT
GCCCGACAATTACCCGGAGGGCATTGACCTGGTGTCCGACGGAGGACGAG
GCCCGCAAGTTTGTGGAGGAATACGACCGGAGATCCCAGGTCGTGTGAAC
GAGTATGCCGAGGCCAACTGGAACTACAGCACCGACATCAGCACGGACAA
CAGCAAGTTGCTGATGGAGAAGAACTTACAGATGGCAAACCACACCGTCA
AGTATGGCACCTGGGCCAGGAAGTTTGACGTGACCAACTTCCAGAATGCC
ACCATGAAGCGGATGATAAAGAAGATTCAGGATCTAGAGCGGGCAGCACT
GCCCACCAAGGAGCTGGAAGAGTATAACCAGATCCTGCTGGACATGGAGA
CCGTTTACAGCGTGGCCTCTGTGTGCCACGAAAATGGCACCTGCCTGCGG
CTCGAGCCTGGCTACCAGGATGGCGGGGACTCCTGGAGGTCCATGTACGA
GATGCCCTTCCTAGAGGAGGAGCTGGAGCAGCTGTTCCAAGAGCTGCAGC
CGCTCTACCTGAACCTGCACGCCTACGTGCGCCGGGCCCTGCACCGCCAC
TACGGGCCCGACGTCATCAACCTGGAGGGCCCCATCCCAGCCCACCTGCT
CGGGAACATGTGGGCACAGAGCTGGTCCAACATCTATGACTTGGTGGCAC
CCTTCCCTTCAGCCCCCAAGATGGATGCCACGGAGGCCATGATAAAGCAG
GGCTGGACACCCCTAAGGATGTTTAAGGAAGCAGACAATTTCTTCACCTC
CCTGGGGCTGCTGCCCATGCCCCCTGAATTCTGGAACAAGTCGATGCTGG
AGAAGCCGACTGATGGGCGGGAAGTGGTGTGCCACGCCTCCGCCTGGGAC
TTCTTCAACGGCAAGGACTTTAGGATCAAGCAGTGCACCTCGGTGAACAT
GGAGGACCTGGTGGTGGCCCACCACGAAATGGGCCACATACAGTACTTCA
TGCAGTACAAGGACTTGCCCGTGACCTTCCGGGAGGGCGCCAACCCCGGC
TTTCACGAGGCCATTGGGGACGTGCTGGCCCTCTCAGTGTCCACCCCCAC
GCACCTGCACAAGATCAACCTGCTGAGCAGTGGGGACGGCGGCTACGAGG
AGGATATCAACTTTCTGATGAAGATGGCGCTCGAGAAGATTGCCTTCATC
CCCTTCAGCTTCCTCGTCGACCAGTGGCGCTGGAGGGTGTTTGATGGAAG
TGTCACCAGGGAGAACTACAACCAGGAGTGGTGGAGCCTCAGGCTGAAGT
ACCAGGGTGTCTGTCCCCCACTGGCCAGATCTCAAGATGACTTTGACCCA
GGGGCCAAGTTCCACATTCCTGCAAGTGTGCCTTACGTCAGGTACTTCGT
CAGCTTTGTCATCCAGTTCCAGTTCCACCAGGCGCTGTGTCAGGCAGCGG
GCCACCAGGGCCCCCTGCACAAGTGTGACATCTACCAGTCCAAGGAGGCC
GGGAAGCTCCTGGCGGATGCCATGAAGCTGGGCTTCAGTCAGCCGTGGCC
CGAAGCCATGCGGCTGATCACGGGCCAGTCCAACATGTCGGCTGCCGCCA
TGATGACCTACTTCAAGCCGCTGCTGGACTGGCTCGTGACGGAGAACGGG
CGGCACGGGGAGAAGCTGGGCTGGCCTCAGTACAACTGGACGCCAAACTC
GGACCAGCTCTACAATGAGACTGTGGCAAAGGCCTTCCTGGAGTTTTACG
AGCGAACAGCCCAGGTTGTATGGAACCAGTTCATGGCGGCCGCCTGGAAC
TATGTCACCAACATCACAAAGAAAAATCAAGAGGAGATGCTGTACAAGGA
CGTGGAGAAGTCCCAGCACACACTGTACTTTGGCACGCGGGCCCGCATGT
TTAAGATCGCCAACTTCCAGGACTCGGATGTGAAGCGCATGCTGAGTAAG
CTGCTGAACGTAGACAAGGCGGCCCTGCCCAAGGAGGAGCTCCGGGAGTA
CAACGAGATTCTGGCCTACATGGAGACCACGTACAGCATGGCCCAGGTCT
GCCTGAATGAGGGGCCCTGCCTGCCCCTGGAGCCTGACCTCGAAGAAGTC
ATGGCCACCTCCCGAGACCAGAAGGAGCTGCTGTGGGCCTGGCAGGGCTG
GCGGGACGCCGTGGGTCGCCAGCTCCGCATGACCTTTGAGCGCTACGTGC
AGCTCAGCAACAAGGCTGCGAATCTCAATGGTTACCAAGACATGGGGGCC
TTGTGGAGGTCCAAGTACGAGTCCGACACGCTGCAGGAAGACCTGGAGCA
GCTGTTCCAGGAGCTGCAGCCGCTCTACCTGAACCTGCATGCCTACGTGC
GCAGGTCCCTCTACCGCTTCTATGGGCCCGAGCTCATCGACCTGAGGGGG
CCCATCCCCGCCCACGTCCTGGGGAACATGTGGGCTCAGTCCTGGGTCAA
CATCTTAGACCTGGCCCTGCCCTTCCCAGAGAAGCCCCCCGAGGACATCA
CGAAGATCATGCAAGGCCAGCACTGGAAGCCTGAGAAAATGTTCCAAGAG
GCTGAAAAATTCTTCACCTCCATGGGGCTGCTTTCCACCCCTCCTGAGTT
CTGGAAAAACTCCATGATGGAAAGGCCAACTGACGGGCGGGAGGTGGAGT
GCCACGCGTCCGCCTGGGACTTCTACAACGGGAAGGACTTCAGGATAAAG
AAGTGCACCGAAGTGACCATAGAAGACCTGCTGTCCATCTTCCACCAGAT
GGGCCACATCCAGTACTTCCTGCAATACAAGAACCTCTCGGTGATCTTCC
GCGCAGGCGCCAACCCAGCCTTCGAGGAGGCCGTGGGGTCGGTGGTCACC
CTTTCAGCCTCTTCCCACAAGCACCTGCTCAACAGAGGCCTGCTCAGCCA
ACAGCACCAGGACAAAGAGGAGGAGGTCAATTTCCTGATGAGCGTTGCCC
TGGAGAAGATCGCCTTCATCCCCTTCGCCTACCTGATGGACCTGTTTCGC
TGGAAGGTCTTTGACGGCACCATCGAGAAGGATGTGTACAACCAGGAGTG
GTGGAACCTCAGGTTGAAGTACCAGGGCCTGTGCCCTCCCATCCCTCGGA
CAGAGGAGGACTTTGATCCAGGCGCCAAGTTCCACATCTCTGCCAGCTTG
CCCTACATACGGTACTTTCTCAGCCTCGTGCTCCAATTCCAGTTCCATGA
AGCACTCTGCAAGGCCTCGGGCCACATGGGGCCGCTGCACCGCTGTGACA
TCTATAACTCCAAGGAGGCTGGGAAGCTCCTGGAGGATGTCCTGAAGCTG
GGCTCGAGCAAGCCCTGGCCAGAGGTCCTGGAGAAGATGACCGGGGAGAC
CAAGGTGTCTACAAAGGCCCTCATGACCTACTTCAAGCCCCTGCTGAACT
GGCTGGTCACTGAGAACGTGCGGCAGGGGGAGATACTGGGCTGGCCAGAC
TTCAGCTGTTCCTTTGAAGGTTTGATGATC



Protein Sequences

>BT14279-PA
MLHRLPEADPPAAPVLHPQGPVEGSSAPISAGLQKPLTFLPSPSAMASPV
YLLVPSWCPQEEAALLSQEFSEAWGQKAKDLFDPVWQNFTDPTLLRIIGA
VRTLGPANLDLEKRQKYNSLLSNMSRIYSTAKVCFPNKTAPCWSLDPELT
NILASSRSYTLLLYAWEGWHNAAGIPLKPLYQDFTALSNEAYKQDGFSDT
GAYWRSWYDSPTFTEDLERLYQQLEPLYLNLHAYVRRALHRRYGDRYINL
RGPIPAHLLGNMWAQSWENIYDTVVPFPDKPNLDVTDVMVQKGWNATHMF
RVAEEFFTSLGLLPMPPEFWAESMLEKPSDGREVVCHASAWDFYNSPSPS
PTCSPCPRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKGQHVSLRRGANPG
FHEAIGDVLALSVSTPAHLHKIGLLDQVTNDTESDINYLLKMALEKIAFL
PFGYLVDQWRWGVFSGRTPPSRYNYDWWYLRTKYQGICPPVVRNETHFDA
GAKFHVPNVTPYIRYFVSFVLQFQFHEALCKEAGHQGPLHQCDIYQSTQA
GAKLRALLQAGSSRPWQEVLKDMVGSDNLDARPLLSYFQPVTQWLEEQNQ
QNGEVLGWPEYQWRPPMPDNYPEGIDLVSDGGRGPQVCGGIRPEIPGRVN
EYAEANWNYSTDISTDNSKLLMEKNLQMANHTVKYGTWARKFDVTNFQNA
TMKRMIKKIQDLERAALPTKELEEYNQILLDMETVYSVASVCHENGTCLR
LEPGYQDGGDSWRSMYEMPFLEEELEQLFQELQPLYLNLHAYVRRALHRH
YGPDVINLEGPIPAHLLGNMWAQSWSNIYDLVAPFPSAPKMDATEAMIKQ
GWTPLRMFKEADNFFTSLGLLPMPPEFWNKSMLEKPTDGREVVCHASAWD
FFNGKDFRIKQCTSVNMEDLVVAHHEMGHIQYFMQYKDLPVTFREGANPG
FHEAIGDVLALSVSTPTHLHKINLLSSGDGGYEEDINFLMKMALEKIAFI
PFSFLVDQWRWRVFDGSVTRENYNQEWWSLRLKYQGVCPPLARSQDDFDP
GAKFHIPASVPYVRYFVSFVIQFQFHQALCQAAGHQGPLHKCDIYQSKEA
GKLLADAMKLGFSQPWPEAMRLITGQSNMSAAAMMTYFKPLLDWLVTENG
RHGEKLGWPQYNWTPNSDQLYNETVAKAFLEFYERTAQVVWNQFMAAAWN
YVTNITKKNQEEMLYKDVEKSQHTLYFGTRARMFKIANFQDSDVKRMLSK
LLNVDKAALPKEELREYNEILAYMETTYSMAQVCLNEGPCLPLEPDLEEV
MATSRDQKELLWAWQGWRDAVGRQLRMTFERYVQLSNKAANLNGYQDMGA
LWRSKYESDTLQEDLEQLFQELQPLYLNLHAYVRRSLYRFYGPELIDLRG
PIPAHVLGNMWAQSWVNILDLALPFPEKPPEDITKIMQGQHWKPEKMFQE
AEKFFTSMGLLSTPPEFWKNSMMERPTDGREVECHASAWDFYNGKDFRIK
KCTEVTIEDLLSIFHQMGHIQYFLQYKNLSVIFRAGANPAFEEAVGSVVT
LSASSHKHLLNRGLLSQQHQDKEEEVNFLMSVALEKIAFIPFAYLMDLFR
WKVFDGTIEKDVYNQEWWNLRLKYQGLCPPIPRTEEDFDPGAKFHISASL
PYIRYFLSLVLQFQFHEALCKASGHMGPLHRCDIYNSKEAGKLLEDVLKL
GSSKPWPEVLEKMTGETKVSTKALMTYFKPLLNWLVTENVRQGEILGWPD
FSCSFEGLMI




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.