BT14634

Link to gene wiki page

[-] General Information


Transcripts for BT14634 BT14634-RA  

NCBI Gene Symbol: PCSK2

Description:
proprotein convertase subtilisin/kexin type 2

Overlapping Locus Information:

NCBI: 281968
Ensembl: ENSBTAG00000008687

Genomic Location: Chr13.18   3040795 .. 3280761    [+]

GO Annotations for BT14634

Biological Process
GO:0006508 ISS  proteolysis
GO:0007399 ISS  nervous system development
GO:0016540 ISS  protein autoprocessing
GO:0030070 IEA  insulin processing
GO:0034230 IEA  enkephalin processing
Molecular Function
GO:0004252 IEA  serine-type endopeptidase activity
GO:0005515 IEA  protein binding
GO:0008233 IEA  peptidase activity
Cellular Component
GO:0005615 IEA  extracellular space
GO:0005625 IEA  soluble fraction
GO:0016020 IEA  membrane
GO:0030141 IEA  secretory granule
GO:0031410 IEA  cytoplasmic vesicle

[-] Transcripts for BT14634

BT14634-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT14634-RA View Text HTML XML
Protein: BT14634-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_174413.2
NCBI Protein: NP_776838.1
Ensembl Transcript: ENSBTAT00000011451
Ensembl Protein: ENSBTAP00000011451

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT14634-RA
ATGAGAGGTGGTTGTATCTCCCAGGGGAAGGCGGCCGCGGGGCTCCTCTT
CTGTGTCATGGTTTTTGCATCTGCTGAGAGACCGGTCTTCACGAATCATT
TTCTTGTGGAGTTGCACAGAGGGGGAGAGGAAGAAGCTCGCCAAGTTGCA
GCAGAGCACGGTTTTGGAGTCCGAAAGCTCCCCTTTGCTGAAGGCCTGTA
CCAGTTTTATCACAATGGCCTGGCCAAGGCCAAGAGAAGACGCAGCCTAC
AGCATCAGCAGCAGCTGGAGAGAGACCCCAGGGTAAAGAGGGCCTTGCAG
CAGGAAGGATTCAACCGGAAAAAGCGAGGGTACAGAGACATCAACGAGAT
CGACATCAACGTGAATGACCCTCTTTTCACGAAGCAATGGTACCTGATCA
ATACCGGGCAAGCTGATGGTACTCCCGGTCTCGACTTGAATGTGGCAGAA
GCCTGGGAGCTGGGATACACAGGGAAAGGTGTTACCATTGGAATTATGGA
CGATGGAATTGACTACCTCCACCCGGACCTGGCCTCGAACTACAACGCTG
AGGCGAGCTACGACTTCAGCAGCAATGATCCCTATCCGTACCCTAGATAC
ACAGACGACTGGTTTAACAGCCACGGGACGAGATGTGCTGGGGAGGTCTC
TGCGGCTGCCAACAATAACATCTGCGGGGTCGGCGTGGCCTACGGCTCCA
AGGTCGCAGGTATCCGGATGCTGGACCAGCCCTTCATGACAGACATCATT
GAGGCTTCCTCCATCAGCCACATGCCTCAGCTGATTGACATCTACAGTGC
CAGCTGGGGCCCCACCGACAACGGGAAGACGGTGGATGGGCCCCGGGAGC
TCACGCTCCAAGCGATGGCGGATGGCGTGAACAAGGGCCGCGGGGGCAAA
GGCAGCATCTACGTGTGGGCCTCGGGCGACGGCGGCAGCTACGATGACTG
CAACTGCGACGGCTATGCATCGAGCATGTGGACCATCTCCATCAACTCGG
CCATCAACGACGGCAGGACCGCGCTCTACGACGAGAGCTGCTCCTCCACG
CTGGCCTCCACCTTCAGTAATGGGCGCAAGCGGAACCCCGAGGCCGGCGT
GGCAACCACAGATTTATATGGCAACTGCACCCTGAGGCATTCTGGGACAT
CCGCGGCTGCTCCCGAAGCAGCCGGAGTGTTCGCACTGGCTTTAGAGGCT
AACCTGGGTCTGACCTGGAGAGACATGCAGCATCTGACTGTGCTCACCTC
CAAGCGGAACCAGCTTCACGACGAGGTCCATCAGTGGCGGAGGAATGGGG
TCGGCCTGGAGTTTAATCACCTCTTTGGCTACGGAGTCCTAGACGCAGGT
GCCATGGTGAAGATGGCCAAGGACTGGAAGACGGTGCCCGAGAGGTTCCA
CTGCGTGGGCGGCTCCGTGCAGAACCCAGAGAAAATTCCGACCACTGGCA
AGCTGGTGCTAACGCTCACGACCGACGCATGCGAGGGGAAGGAAAACTTC
GTCCGCTACCTGGAGCATGTCCAAGCGGTTGTCACGGTCAACGCAACCAG
GAGAGGGGACCTGAACATCAACATGACGTCCCCCATGGGCACCAAGTCCA
TCCTGCTGAGCCGGCGCCCCCGGGACGACGACGCCAAGGTGGGCTTCGAC
AAGTGGCCTTTCATGACCACCCATACTTGGGGGGAGGACGCCAGGGGCAC
CTGGATCCTGGAGCTGGGCTTCGTGGGGAGTGCGCCCCAGAAGGGGGTGC
TGAAGGAGTGGACGCTGATGCTGCACGGCACGCAGAGTGCCCCCTACATT
GACCAGGTGGTGCGGGATTACCAGTCCAAGCTGGCCATGTCCAAGAAGGA
GGAGCTGGAGGAAGAGCTGGACGAGGCCGTGCAGAGAAGCCTGAAGAGCA
TCCTTGGCAAGGAC



Protein Sequences

>BT14634-PA
MRGGCISQGKAAAGLLFCVMVFASAERPVFTNHFLVELHRGGEEEARQVA
AEHGFGVRKLPFAEGLYQFYHNGLAKAKRRRSLQHQQQLERDPRVKRALQ
QEGFNRKKRGYRDINEIDINVNDPLFTKQWYLINTGQADGTPGLDLNVAE
AWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRY
TDDWFNSHGTRCAGEVSAAANNNICGVGVAYGSKVAGIRMLDQPFMTDII
EASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSST
LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEA
NLGLTWRDMQHLTVLTSKRNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAG
AMVKMAKDWKTVPERFHCVGGSVQNPEKIPTTGKLVLTLTTDACEGKENF
VRYLEHVQAVVTVNATRRGDLNINMTSPMGTKSILLSRRPRDDDAKVGFD
KWPFMTTHTWGEDARGTWILELGFVGSAPQKGVLKEWTLMLHGTQSAPYI
DQVVRDYQSKLAMSKKEELEEELDEAVQRSLKSILGKD




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.