BT15293

Link to gene wiki page

[-] General Information


Transcripts for BT15293 BT15293-RA  

NCBI Gene Symbol: TGM2

Description:
transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase)

Overlapping Locus Information:

NCBI: 281528
Ensembl: ENSBTAG00000016208

Genomic Location: Chr13.42   3213939 .. 3246622    [-]

GO Annotations for BT15293

Biological Process
GO:0018149 IEA  peptide cross-linking
GO:0045785 IEA  positive regulation of cell adhesion
Molecular Function
GO:0003810 IEA  protein-glutamine gamma-glutamyltransferase activity
GO:0005509 IEA  calcium ion binding
GO:0008415 IEA  acyltransferase activity
GO:0016740 IEA  transferase activity

[-] Transcripts for BT15293

BT15293-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT15293-RA View Text HTML XML
Protein: BT15293-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_177507.2
NCBI Protein: NP_803473.1
Ensembl Transcript: ENSBTAT00000021569
Ensembl Protein: ENSBTAP00000021569

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT15293-RA
ATGGCCGAGGAGCTGGTCCTGGAGAGATGTGACCTGGAGCTGGAGGCCAA
TGGCCGTGACCACCACACAGCTGACCTGTGCAGGGAAAGGCTGGTAGTGC
GGCGGGGCCAGCCCTTCTGGCTGACTCTGCACTTTGAGGGCCGGAACTAT
GAGGCCAGCGTGGACAGCCTCACCTTTTGTGCTGTGACTGGCCCAGACCC
CAGTGAGGAGGCCGGGACCAAGGCCCTCTTCAGGCTGTCCGATGCTACGG
AGGAGGGGGCCTGGGCAGCGGTGGCAGCGGACCAGCGAGACAGCACCCTC
TCGCTGCACCTCAGCACCCCGGCCAATGCCCCCGTTGGCCATTACCGCCT
CAGCTTGGAGGCCTCCACTGGCTACCAGGGCTCCAGTTTCATGCTGGGTC
AGTTCACCCTGCTCTTCAACAGCTGGTGTCCAGCGGATGCTGTGTACCTG
GACTCAGATGAGGAGCGGCAAGAATACGTCCTTACCCAGCAAGGCTTCAT
CTACCAGGGCTCAGCCAAGTTCATCAAGAACATACCTTGGAATTTTGGGC
AGTTTGAAGAAGGGATCCTAGACATCTGCCTGATGCTCCTGGATGTCAAC
CCCAAGTTCCTGAGGAATGCCGGCCGAGACTGCTCCCGCCGCAGTAGTCC
GGTCTATGTGGGCCGGGTGGTGAGCGGCATGGTCAACTGCAACGATGACC
AGGGCGTGCTGCTGGGGCGCTGGGACAACAACTACGCAGACGGCATCAGC
CCCATGTCCTGGATCGGCAGCGTGGACATCCTGCGGCGCTGGAAGAGAGA
TGGCTGCCAGCGCGTCAAGTACGGCCAGTGCTGGGTGTTCGCGGCTGTGG
CCTGCACCGTGCTGCGGTGCCTTGGCATCCCTACCCGAGTCGTGACCAAC
TATAACTCAGCCCATGACCAGAACAGCAACCTGCTCATCGAGTACTTCCG
CAATGAGTTCGGGGAGATCCAGAGTGACAAGAGCGAGATGATCTGGAACT
TCCACTGCTGGGTGGAGTCGTGGATGACCAGGCCAGACCTGCAGCCGGGG
TACGAGGGGTGGCAGGCCCTCGACCCCACGCCCCAGGAGAAGAGCGAAGG
GACTTACTGCTGTGGCCCGGTTCCCGTTCGTGCCATCAAGGAGGGTGACC
TGAGCACCAAATACGACGCCCCTTTCGTCTTTGCCGAAGTCAACGCTGAC
GTGGTGGACTGGATCCGGCAGGACGATGGGTCTCTGCACAAATCCATCAA
CCACTCCCTGGTGGTGGGGCTGAAGATCAGCACAAAGTGTGTGGGCAGAG
ATGATCGGGAGGACATCACCCACAGCTACAAGTACCCGGAGGGGTCCCCA
GAGGAAAGGGAAGCCTTCACAAGAGCCAACCATCTGAACAAACTGGTTAA
CAAAGAGGAGACAGGGGTGGCCATGCGGATCCGTGTGGGCGAGGGCATGA
ACAGAGGCTGCGACTTCGACGTCTTTGCCCACATCACCAACAGCACCCCT
GAGGAGCACACTGGCCGCCTCCTGCTCTGTGCCCGCACTGTCAGCTACAA
TGGGATCCTGGGACCTGAGTGCGGCACCAAGGATCTGCTCAGCCTTTCCC
TGGAGCCCTACTCTGAGAAGAGCATTCCCCTTCGAATCCTCTACGAAAAG
TACTGTGATTGCCTGACCGAATCGAACCTTATCAAGGTGCGGGGCCTCCT
TATTGAGCCAGCTGCCAATAGCTACCTGCTGGCCGAGAGGGACATCTACC
TGGAGAACCCAGAAATCAAGATCCGGATCCTGGGAGAGCCCAAGCAGAAC
CGCAAGCTGGTGGCTGAGATATCTCTGCAGAACCCGCTCACTGTGGCGCT
GTCGGGCTGCACCTTCACTGTGGAGGGAGCAGGCCTGATTGAGGAGCAGA
AGACTGTGGACATCCCAGACCCCGTGGAAGCAGGGGAGGAAGTCAAGGTG
AGGGTGGACCTGCTGCCTCTGTACGTGGGCCGCCACAAGCTGGTGGTGAA
CTTCGAGAGCGATAGGCTGAAGGCCGTGAAGGGCTTCAGGAACGTCATCG
TTGGCCCCTCC



Protein Sequences

>BT15293-PA
MAEELVLERCDLELEANGRDHHTADLCRERLVVRRGQPFWLTLHFEGRNY
EASVDSLTFCAVTGPDPSEEAGTKALFRLSDATEEGAWAAVAADQRDSTL
SLHLSTPANAPVGHYRLSLEASTGYQGSSFMLGQFTLLFNSWCPADAVYL
DSDEERQEYVLTQQGFIYQGSAKFIKNIPWNFGQFEEGILDICLMLLDVN
PKFLRNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYADGIS
PMSWIGSVDILRRWKRDGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQSDKSEMIWNFHCWVESWMTRPDLQPG
YEGWQALDPTPQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNAD
VVDWIRQDDGSLHKSINHSLVVGLKISTKCVGRDDREDITHSYKYPEGSP
EEREAFTRANHLNKLVNKEETGVAMRIRVGEGMNRGCDFDVFAHITNSTP
EEHTGRLLLCARTVSYNGILGPECGTKDLLSLSLEPYSEKSIPLRILYEK
YCDCLTESNLIKVRGLLIEPAANSYLLAERDIYLENPEIKIRILGEPKQN
RKLVAEISLQNPLTVALSGCTFTVEGAGLIEEQKTVDIPDPVEAGEEVKV
RVDLLPLYVGRHKLVVNFESDRLKAVKGFRNVIVGPS




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.