BT16876

Link to gene wiki page

[-] General Information


Transcripts for BT16876 BT16876-RA  

NCBI Gene Symbol: NEU4

Ensembl Gene Symbol: NEU4

Description:
sialidase 4

Overlapping Locus Information:

NCBI: 528030
Ensembl: ENSBTAG00000014833

Genomic Location: Chr3.107   242090 .. 244434    [+]

[-] Transcripts for BT16876

BT16876-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT16876-RA View Text HTML XML
Protein: BT16876-PA View Text HTML XML

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT16876-RA
ATGGGGACCCCGCGTGTCCCCGCGCGGACCGTCCTTTTCCAGCGCGAGCG
GACGGGCCTGACCTACCGCGTGCCCGCGCTGCTCTTCGCGCCCCCCGGGC
CCACCCTGCTGGCCTTCGCGGAGCAGAGGCTCAGCCCCGACGACGCCCAC
GCCCACCGTCTGGTGCAGAGGACCGGCACGCTAGCCGGGGGCTCCGTGCG
GTGGGGCGCCCCGCGCGTGCTGGGGACGGCGGCCCTGGACGAGCACCGCT
CCATGAACCCCTGCCCGGTGCACGATGAGCGCACGGCCACGGTCTTCCTC
TTCTTCATCGCCGTGCGTGGCCGCACCCCCGAGGCCGCGCAGATCGCCTC
GGGCAGGAACGCCGCGCGCCTCTGCTGCGTTACCAGCCGGGACGCGGGGC
GCAGCTGGGGCGGCGCGCGGGACCTCACGGCGGAGGCGGTGGGCAGCGCT
GAGCAGGACTGGGCCACGTTTGCCGTGGGGCCTGGCCACGGCGTGCAGTT
GCGCTCTGGCCGCCTGCTGGTGCCGGCCTACACCTACCACGTGGTCCGGC
GGGAGTGCTTCGGCCGGATCTGCAGGACCCGCCCCCAGTCCTTCGCGTTC
TACAGTGATGACCACGGCCGCACCTGGCAGCGCGGGGGCCTCGTGCCCAG
CCTGCGCTCGGGCGAGTGCCAGCTGGCCGCGGTGGACGGCGGGCGGGCCG
GTGGCGTCCTCTACTGCAATGCTCGGAGCCCCCTGGGCAGCCGCGTGCAG
GCCCTCAGCGTGGACGAGGGCACCTCCTTCCTGCCCGGGGAGCTGGTGCC
TGCCCTGGCCGAGACCGCCCGGGGCTGCCAGGGCAGCATCGTGGGCTTCC
CGGCCCCACCCGCCAGCGGGTGGAAGGATGAGGGGTGGTCCGCGGGCACC
AGCAACCCTCTCCGCCTTCCGCACCTCTGTCCTGGGGCCAGGGAGGCCCC
AGAGGAGGGCACTGGAGACACCCGTGGGGGCGGGGGGCTGGGTGGGATGG
AGGGCTGTGGCAACGGCCCCAGGGAGCCTGGTGAGAACTGGGGCTCCTGG
GCCTCAGTGCTCCTGGGACCTCTTGCAGCCTTGTCGCAGAGCCCCACGTG
GTTGCTGTACTCCCACCCAGTGGGGCGCAGGGCTCGGCTCCACATGGGTG
TCCGCCTGAGCCGGTCCCCGCTGGACCCCCACAGCTGGACGGAGCCCTGG
GTCATCCACCAGGGCCCCAGTGGCTACTCGGACCTGGCATCCATCGGGCC
TGCCCCTGGGGGCGTCCCGACCTTCGCCTGTCTGTTCGAGAGTGGGGCCA
GGGTCTCCTATGAGGAGATCTCCTTCTGCATGTTTTCCCTGCAGGAGGTC
CTGGAGAACGTGAGGCTAGGGGGAGTGCACCCCGGCCCTGGAGACAAGCC
TGGAGACAAGCCTGCGGGGCGCTGCCAGCCCTCC



Protein Sequences

>BT16876-PA
MGTPRVPARTVLFQRERTGLTYRVPALLFAPPGPTLLAFAEQRLSPDDAH
AHRLVQRTGTLAGGSVRWGAPRVLGTAALDEHRSMNPCPVHDERTATVFL
FFIAVRGRTPEAAQIASGRNAARLCCVTSRDAGRSWGGARDLTAEAVGSA
EQDWATFAVGPGHGVQLRSGRLLVPAYTYHVVRRECFGRICRTRPQSFAF
YSDDHGRTWQRGGLVPSLRSGECQLAAVDGGRAGGVLYCNARSPLGSRVQ
ALSVDEGTSFLPGELVPALAETARGCQGSIVGFPAPPASGWKDEGWSAGT
SNPLRLPHLCPGAREAPEEGTGDTRGGGGLGGMEGCGNGPREPGENWGSW
ASVLLGPLAALSQSPTWLLYSHPVGRRARLHMGVRLSRSPLDPHSWTEPW
VIHQGPSGYSDLASIGPAPGGVPTFACLFESGARVSYEEISFCMFSLQEV
LENVRLGGVHPGPGDKPGDKPAGRCQPS




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.