BT18154

Link to gene wiki page

[-] General Information


Transcripts for BT18154 BT18154-RA  

NCBI Gene Symbol: TGM5

Description:
transglutaminase 5

Overlapping Locus Information:

NCBI: 514767

Genomic Location: Chr21.51   288495 .. 322347    [-]

[-] Transcripts for BT18154

BT18154-RA

Gene Model Source: RefSeq 

Sequences:

Transcript: BT18154-RA View Text HTML XML
Protein: BT18154-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_001102009.1
NCBI Protein: NP_001095479.1
Ensembl Transcript: ENSBTAT00000045466
Ensembl Protein: ENSBTAP00000042854

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT18154-RA
ATGGCGGAAGGGCTGGAGGTGGCCCTCACCGACCTCCAGAGCTCCTGGAA
CAATGTGCAGCACCACACAGACGAGATCAGCTCCAGTCGCCTCCTTGTTC
GCCGGGGCCAGGCCTTCAACATCACCCTGTACTTCAGGAACCGGGCCTTC
CAGCCAGGCCTGGACAACATCATCTTTGTGACTGAGACTGGACCACTGCC
AGATCTGTCCAAGGGGACTCGAGCCGTGTTCAGCCTGGAAGGTCACCCTG
GCTCCAGCCCCTGGATTGCCTCACTGCAGACCATTGGGGCCAATTCCCTG
GAGGTGAGCCTGTGTGCCCCTCCTATGGCAGCTGTGGGTCGGTACCTCTT
GAAGGTTCACATCAAATCCCTACAGGGGCCTGTCACAGCCTACAAGCTCG
GGGAGTTCATCCTGCTCTTCAATCCCTGGTGCCCAGAGGATGCTGTCTAC
CTGGAGAGTGAACCCCAGAGGCAGGAATATGTCATGAATGATTATGGCTT
CATCTATCAAGGGAACAAGAACTGGATCCGCCCCTGCCCCTGGAATTATG
GACAATTTGAAGAGAATATCATAGACATCTGTCTGGAGCTGCTAGACAAG
AGCCTGAACTTCCAGATTGACCCAGCCACAGACTGTGCCCTACGGGGCAG
CCCGGTCTACATCAGCAGAGTGGTGTCCGCCATGATCAACAGCAACGATG
ACAATGGGGTGCTCAATGGAAACTGGGGCGAGAATTACTCAGATGGCACC
AACCCCACAGAGTGGATGGGCAGCGTGGCCATCCTGAAGCAGTGGCATGC
CACGGGCTGCCAGCCAGTGCGTTACGGGCAGTGCTGGGTCTTTGCTGCTG
TCACATGCACAGTGATGAGGTGTCTGGGGATCCCCACCCGAGTGATCACC
AACTTCAACTCTGGCCACGACACAGACGGAAACCTGATCATTGATGAGTA
TTATGACAACACAGGCAGGATTTTGGAGAATAAGAAGAAGGACAGTGTCT
GGAATTTCCACGTCTGGAATGAATGCTGGATGGCACGGAACGACCTCCCA
CCTGGATTCGGAGGCTGGCAGGTGCTGGACGCTACACCTCAGGAGACAAG
CAATGGCCTCTACTGCTGCGGCCCTGCCTCCGTCAGAGCCATCAAAGAAG
GAGAGGTGGATCTGAACTACGACACAGCCTTCGCCTTTTCCATGGTGAAT
GCTGACTGTATGGCCTGGCTGGTCTTTGGAGGGAAGGAGCAGAAACTTCA
CCAGGACACCAGTACTGTTGGTAATTTTATTAGCACCAAGAGCATCCAGA
GTGATGAGCGGGATGACATCACGGAAAACTACAAGTATAGAGAAGCAAAG
ACCTATCCCTGCAAAATCACCTATTCCCAGTACAGCCAGTACCTGTCCAC
AGACAAGCTGATCCGCATCAGTGCCCTGGGTGAAGAGAAGAACAGTCCTG
AAAAGATCCTGGTGAAGAAGATCATCACCTTAGCCTATCCCAGCATCGTG
ATTAATGTTTTAGGAGCAGCCATTGTGAACCAGCCGCTCTCTATACAGGT
GGTATTTTCAAACCCCCTCTCGGAGCAGGTTGAAGACTGTGTGCTGACTG
TGGAAGGAAGCGGTCTCTTCAGGAGACAGCAGAGAGTCCTCATTGGAGTC
CTCAAACCCCATCACAGAGCCAGTCTCACTCTGGAGACTATCCCCTTCAA
GAGTGGCCAAAGGCAAATCCAAGCGAATCTGAGGAGCAACAAATTTAAGG
ACATCAAGGGTTACACGAATGTCTATATTGGGTTA



Protein Sequences

>BT18154-PA
MAEGLEVALTDLQSSWNNVQHHTDEISSSRLLVRRGQAFNITLYFRNRAF
QPGLDNIIFVTETGPLPDLSKGTRAVFSLEGHPGSSPWIASLQTIGANSL
EVSLCAPPMAAVGRYLLKVHIKSLQGPVTAYKLGEFILLFNPWCPEDAVY
LESEPQRQEYVMNDYGFIYQGNKNWIRPCPWNYGQFEENIIDICLELLDK
SLNFQIDPATDCALRGSPVYISRVVSAMINSNDDNGVLNGNWGENYSDGT
NPTEWMGSVAILKQWHATGCQPVRYGQCWVFAAVTCTVMRCLGIPTRVIT
NFNSGHDTDGNLIIDEYYDNTGRILENKKKDSVWNFHVWNECWMARNDLP
PGFGGWQVLDATPQETSNGLYCCGPASVRAIKEGEVDLNYDTAFAFSMVN
ADCMAWLVFGGKEQKLHQDTSTVGNFISTKSIQSDERDDITENYKYREAK
TYPCKITYSQYSQYLSTDKLIRISALGEEKNSPEKILVKKIITLAYPSIV
INVLGAAIVNQPLSIQVVFSNPLSEQVEDCVLTVEGSGLFRRQQRVLIGV
LKPHHRASLTLETIPFKSGQRQIQANLRSNKFKDIKGYTNVYIGL




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.