BT18476

Link to gene wiki page

[-] General Information


Transcripts for BT18476 BT18476-RA  

NCBI Gene Symbol: TGM6

Description:
transglutaminase 6

Overlapping Locus Information:

NCBI: 536356

Genomic Location: Chr13.32   7402970 .. 7430015    [-]

GO Annotations for BT18476

Biological Process
GO:0018149 IEA  peptide cross-linking
Molecular Function
GO:0003810 IEA  protein-glutamine gamma-glutamyltransferase activity

[-] Transcripts for BT18476

BT18476-RA

Gene Model Source: RefSeq 

Sequences:

Transcript: BT18476-RA View Text HTML XML
Protein: BT18476-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: XM_616484.3
NCBI Protein: XP_616484.3

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT18476-RA
ATGGGAAATGTCCGAGAGCTGGGTCCCATCTCCCTGTGCTCTCCCTGCCC
AGGGCTCAGAGTCACTGAGGTGGACTGGCAGCGGCTGCGCAACGGCACTG
CACACCACACCCAGGAGTACCCCGGCTCCAACCTGGTGGTCCGCAGGGGC
CAGAGGTTCACCTTCACACTGGAGCTGAACAGACCCCTGGAGAGCGAGGA
GACCCTCATCTTCACCGTGGAGACAGGACCCCAGGCTTCTGAGGCCCTCC
ACACCAAAGCCGTGTTCCAGACATCAGAGCTGGAGCGGGGTGACACCTGG
ATGGCAGTGAAGGAGGCTCAGACAGAGAACACCACGACCTTCAGCCTTGC
CAGCCCTCCCAATGCCGTCATTGGCCGTTACCAGCTGAGCGCCAGGGTTT
CCTCTCGCCGCAAACATAGTGACCGGAAGCTGGGCGAGTTTGTTCTCCTT
TTCAACCCATGGTGCCCAGAGGACGACGTGTTCCTGGACTCAGAGGAAGA
GAGACAAGAGTACGTGCTCAACGACAGCGGGATCATCTTCCGGGGTGTGG
AGAAGCGCATCCGAGCCCAAGGCTGGAACTTCGGGCAGTTTGAGGAGGAC
ATCCTGAACATCTGCCTCTCCATCCTGGACCGAACCCCTAGTTACCAAGA
CGACCCAGCCACCGACGTGTCCCACCGCCATGACCCCGTCTACATCACCA
GAGCCGTCAGCGCCATGGTGAACAGCAACAACGACCGGGGCGTGGTTCAA
GGCCAGTGGCAGGGCAAGTACGGCGGCGGCACCAGCCCTCTGCACTGGCG
TGGCAGCGTGGCCATTCTGCACAAGTGGTTCAAGGGCAGGTTCAAGCCCG
TCAAGTACGGCCAGTGCTGGGTCTTCGCTGGAGTCATGTGCACAGTCCTC
AGGTGCTTGGGAATCGCGACACGGGTTGTGTCCAACTTTAACTCGGCCCA
TGACACGGACAGGAACCTGAGTGTGGACAAGTACGTGGACTCCTTCGGGC
GAACGCTGGAAGACCTGACAGAAGACAGCATGTGGAATTTCCATGTCTGG
AATGAGAGCTGGTTTGCCCGGCGGGACCTGGGCCCCTCTTACAATGGTTG
GCAGGTTCTGGATGCCACCCCCCAGGAGGAGAGCGAAGGCGTGTTCCGGT
GTGGCCCGGCCTCCGTCACCGCCATCCGCGAGGGCGACGTGCATCTGGCC
CACGATGGTCCTTTCGTGTTTGCGGAGGTCAACGCAGACTACATCACCTG
GCTTTGGAATGAGGATGAGAGCCGGGAGCGTGTGTACTCAGACACGAAGA
AGATCGGGCGGTGCATCAGCACCAAGGCGGTGGGCAGCGACTCCCGCGTG
GACATCACCAGCCTCTACAAGTATCCGGAAGGGTCCCGGAAGGAGAGGCA
GGTGTACAGCAAGGCCGTGAAGAAGCTGTTCAGTGTGGAAGCCTCTGGAA
GGAGGGCCCGGGTCCGCAGAGGGGGCGGCCGTGGTCTCTGGCATGATGAC
CTCCTGGAGCCTGCCACCAAGCCCAGCATCACCGGCAAGTTCAAGGTGCT
GGAGCCACCGGTGCTGGGTCACGACCTGAAGCTGGCCCTGTGCTTGACCA
GCCTCACCTCCCGGGCCCAGCGGGTCCAAGTCAACTTGAGCGGTGCCACC
ATCCTTTACACCCGCAGGCCAGTGGCAGAGATCCTGCACGAATCCCACAC
AGTGAAGCTAGGGCCAGAAGAAGAGAAAAAGATCCCAATTGCAATATCTT
ATTCTCAATATAAGGAAGACCTGACAGAGGACAAGAAGATCCTGTTGGCT
GCCATGTGCCTTGTGACCAAAGGAGAGAAGCTCCTGGTGGAGAAGGACAT
TACTCTGGAGGACTTCATTACCATCAAGGTGCTTGGCCCAGCCGTGGTGG
GGGTGGCAGTTGCAGTAGAAGTGATGGTGCTTAACCCACTCTCGGAGAGA
GTGAAAGACTGTTCGCTAATGGTGGAGGGCAGTGGCCTTCTCCAGGGACA
GCTCAGCATCGATGTGCCCAGCCTGGATCCCCAAGAGAAGGCCTCGGTCC
AATTCAAGATCACCCCCTTCAAGAGCGGCCCACGGCAGCTGCAGGTAGAC
TTCGTCAGCCCCCACTTCCCGGACATCAAGGGCTTTGTGATCATCCACGT
GGCCACAGCTAAA



Protein Sequences

>BT18476-PA
MGNVRELGPISLCSPCPGLRVTEVDWQRLRNGTAHHTQEYPGSNLVVRRG
QRFTFTLELNRPLESEETLIFTVETGPQASEALHTKAVFQTSELERGDTW
MAVKEAQTENTTTFSLASPPNAVIGRYQLSARVSSRRKHSDRKLGEFVLL
FNPWCPEDDVFLDSEEERQEYVLNDSGIIFRGVEKRIRAQGWNFGQFEED
ILNICLSILDRTPSYQDDPATDVSHRHDPVYITRAVSAMVNSNNDRGVVQ
GQWQGKYGGGTSPLHWRGSVAILHKWFKGRFKPVKYGQCWVFAGVMCTVL
RCLGIATRVVSNFNSAHDTDRNLSVDKYVDSFGRTLEDLTEDSMWNFHVW
NESWFARRDLGPSYNGWQVLDATPQEESEGVFRCGPASVTAIREGDVHLA
HDGPFVFAEVNADYITWLWNEDESRERVYSDTKKIGRCISTKAVGSDSRV
DITSLYKYPEGSRKERQVYSKAVKKLFSVEASGRRARVRRGGGRGLWHDD
LLEPATKPSITGKFKVLEPPVLGHDLKLALCLTSLTSRAQRVQVNLSGAT
ILYTRRPVAEILHESHTVKLGPEEEKKIPIAISYSQYKEDLTEDKKILLA
AMCLVTKGEKLLVEKDITLEDFITIKVLGPAVVGVAVAVEVMVLNPLSER
VKDCSLMVEGSGLLQGQLSIDVPSLDPQEKASVQFKITPFKSGPRQLQVD
FVSPHFPDIKGFVIIHVATAK




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.