BT19008

Link to gene wiki page

[-] General Information


Transcripts for BT19008 BT19008-RA  

NCBI Gene Symbol: HK2

Description:
hexokinase 2

Overlapping Locus Information:

NCBI: 788926
Ensembl: ENSBTAG00000013108

Genomic Location: Chr11.7   112048 .. 175404    [-]

GO Annotations for BT19008

Biological Process
GO:0005975 IEA  carbohydrate metabolic process
GO:0006096 IEA  glycolysis
Molecular Function
GO:0004396 IEA  hexokinase activity
GO:0005524 IEA  ATP binding

[-] Transcripts for BT19008

BT19008-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT19008-RA View Text HTML XML
Protein: BT19008-PA View Text HTML XML

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT19008-RA
ATGATTGCCTCACATCTGCTCGCCTACTTCTTTACGGAGCTCAACCACGA
CCAAGTGCAGAAGGTTGACCAGTATCTCTACCACATGCGTCTTTCTGATG
AAACTCTTCTGGAGATTGCTAAGCGTTTTCGCAAGGAGATGGAGAAAGGG
CTTGGAGCCACCACTCACCCTACGGCTTCAGTAAAAATGCTGCCTACTTT
TGTGAGGTCTACTCCAGACGGAACAGAACATGGAGAGTTCCTGGCTCTGG
ACCTTGGAGGGACCAACTTCCGTGTGCTTTGGGTAAGAGTAACAGACAAT
GGACTCCAGAAGGTTGAGATGGAGAGCCAGATCTATGCCATCCCCGAGGA
CATCATGCGAGGCAGTGGCACCCAGCTGTTTGATCACATTGCTGAATGCC
TGGCCAACTTCATGGATAAGCTACAAATCAAAGATAAGAAGCTCCCTTTG
GGTTTTACCTTCTCGTTCCCCTGCCTCCAAACAAAACTAGACGAGAGTTT
CCTGGTCTCGTGGACCAAGGGGTTCAAGTCCAGTGGTGTGGAAGGGAAAG
ATGTGGTTACTCTGATCCGGAAGGCCATCCAGAGGAGAGGGGACTTTGAT
ATTGATATTGTGGCTGTAGTGAATGATACCGTTGGGACCATGATGACCTG
TGGCTATGATGACCAGAACTGTGAGATTGGTCTCATTGTGGGCACAGGCA
GCAATGCTTGCTACATGGAAGAGATGCGCCACATCGACACGGTGGAGGGC
GACGAGGGCCGGATGTGTATCAATATGGAGTGGGGGGCCTTTGGGGATGA
CGGCGCGCTTGATGACATCCGTACGGAGTTTGATCAGGAGATCGACATGG
GCTCTCTGAACCCCGGGAAGCAACTATTTGAAAAGATGATCAGTGGAATG
TACATGGGGGAACTGGTGAGGCTTATCCTGGTGAAGATGGCCAAGGAGGA
GCTGCTTTTTGGGGGGAAGCTCAGCCCTGAACTTCTTGCCACAGGCCATT
TTGAGACCAAAGATGTTTCAGATATTGAAGGGGAGAAGGATGGCATCCAG
AAGGCCCGTGAGATCCTGGTGCGGCTGGGTCTGGACCCAACACATGAGGA
CTGTGTGGCCACTCATCGGGTCTGCCAGATCGTGTCCACACGCTCAGCCA
GCCTGTGCGCGGCCACGCTGGCAGCCGTGCTGTGGCGCATCAAGGAGAAC
AAAGGCGTGGACCGGCTGCGCTCCACTGTCGGGGTCGACGGCTCAGTCTA
CAAGAAGCACCCCCACTTTGCCAAGCGTCTTCACAAGACCGTGCGGCGCC
TCGTGCCTGACTGTGACGTCCGCTTCCTCCGCTCTGAGGATGGCAGTGGC
AAGGGGGCAGCCATGGTGACGGCAGTGGCCTATCGGCTGGCTGATCAGCA
CCGAGCCCGCCAGAAGACCCTGGAGTCTCTGAAGCTGAGCCGTGAGCAGC
TGCTGGAGGTCAAGAGGAGGATGAAGATAGAAATGGAGCGAGGTCTGAGC
AAGGAGACTCACGCCATTGCTCCTGTCAAGATGCTGCCCACCTACGTGTG
TGCCACCCCTGATGGCACAGAGAAAGGAGACTTCCTTGCCTTGGACCTTG
GGGGTACCAATTTCCGGGTCCTGCTGGTGCGTGTGAGGAATGGGAAGCGA
CGCGGGGTGGAGATGCACAACAAGATCTACTCTATCCCACAGGAGGTCAT
GCATGGCACAGGGGACGAGCTCTTCGACCACATCGTCCAGTGCATTGCAG
ACTTCCTGGAGTACATGGGCATGAAGGGTGTGTCCCTGCCTCTAGGTTTC
ACTTTCTCCTTCCCCTGCCAGCAGAACAGCCTGGACGAGAGCATCCTCCT
GAAGTGGACTAAAGGCTTCAAGGCGTCTGGCTGCGAGGGTGAGGACGTAG
TTATGCTGCTGAAGGAAGCCATCCACCGGCGAGAGGAGTTTGACCTGGAT
GTGGTTGCTGTGGTGAACGATACAGTTGGGACTATGATGACCTGTGGCTA
TGAAGACCCTCACTGTGAAGTCGGCCTCATTGTTGGCACAGGCAGCAATG
CCTGCTACATGGAGGAGATGCGGAATGTTGAGCTGGTGGAAGGGGAAGAG
GGGCGGATGTGTGTCAACATGGAGTGGGGGGCCTTCGGGGACAACGGATG
CCTCGATGACTTGCGCACAGAGTTTGATGCAGCTGTGGATGAACTTTCCC
TCAACCCTGGCAGACAGAGGTTTGAGAAAATGATCAGCGGCATGTACCTG
GGCGAGATTGTTCGTAACATCCTCATCGATTTCACCAAGCGTGGGCTGCT
CTTCCGTGGCCGCATCTCAGAGCGGCTCAAGACAAGGGGAATCTTTGAAA
CCAAGTTCCTGTCTCAGATTGAGAGG



Protein Sequences

>BT19008-PA
MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEIAKRFRKEMEKG
LGATTHPTASVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVRVTDN
GLQKVEMESQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKDKKLPL
GFTFSFPCLQTKLDESFLVSWTKGFKSSGVEGKDVVTLIRKAIQRRGDFD
IDIVAVVNDTVGTMMTCGYDDQNCEIGLIVGTGSNACYMEEMRHIDTVEG
DEGRMCINMEWGAFGDDGALDDIRTEFDQEIDMGSLNPGKQLFEKMISGM
YMGELVRLILVKMAKEELLFGGKLSPELLATGHFETKDVSDIEGEKDGIQ
KAREILVRLGLDPTHEDCVATHRVCQIVSTRSASLCAATLAAVLWRIKEN
KGVDRLRSTVGVDGSVYKKHPHFAKRLHKTVRRLVPDCDVRFLRSEDGSG
KGAAMVTAVAYRLADQHRARQKTLESLKLSREQLLEVKRRMKIEMERGLS
KETHAIAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVRNGKR
RGVEMHNKIYSIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGF
TFSFPCQQNSLDESILLKWTKGFKASGCEGEDVVMLLKEAIHRREEFDLD
VVAVVNDTVGTMMTCGYEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEE
GRMCVNMEWGAFGDNGCLDDLRTEFDAAVDELSLNPGRQRFEKMISGMYL
GEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIER




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.