BT19643

Link to gene wiki page

[-] General Information


Transcripts for BT19643 BT19643-RA  

NCBI Gene Symbol: SUHW2

Description:
suppressor of hairy wing homolog 2

Overlapping Locus Information:

NCBI: 517697
Ensembl: ENSBTAG00000001005

Genomic Location: Chr17.51   84577 .. 86215    [-]

GO Annotations for BT19643

Molecular Function
GO:0008270 IEA  zinc ion binding
Cellular Component
GO:0005622 IEA  intracellular

[-] Transcripts for BT19643

BT19643-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT19643-RA View Text HTML XML
Protein: BT19643-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_001077935.1
NCBI Protein: NP_001071403.1
Ensembl Transcript: ENSBTAT00000001332
Ensembl Protein: ENSBTAP00000001332

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT19643-RA
ATGGAACCACCATGTATGTTATGTGAAGAAGACCAAGAGCCAGAACCACA
GAAAAGCGTAGGAGAAACCAAACAAGTAGATGATGAAGATGCTGAACTGA
TCTTTGTTGGAGTGGAACATGTAAATGAAGATGCTGATCTGATCTTTGTT
GGAATGACCTCAAATTCAAAACCAGTCGTTTCAAACATATTGAACAGAGT
TACCCCAGGTTCATGTTCAAGGAGAAAAAGGTATGGTCACTTCAGGAAAG
ATAATGCTCACAAATTACAGCCTGTTAGTCATGTGACTCGTACATCCGAA
GCAAAGATTGTCTTGCCAGTTTCTGACTCTGAATCAAGATCAACAGATAG
TCCTATTATTATTGAGCCTTTGTCTAAACCTGATTATAAAAATATTTCAC
CACAAATAGTGCCTAATAGCTTTTCAGAGTTATGTTCTCCTTTGATTACC
TTCACAAGTTCATTGCAGCATCCAGTAGAAACAACAGTTTCTGCAGGAGA
TATGAATAAAAGTCCTCGTGTATCAAAGCGACTTTCCACTTCTGAAACAA
ATAGCACAAATCCCAAAAGGCCTAAACTCAGTGATGGAATTATAGGGGAA
CATTCTTTAGCTTTGTCCCCTTCAGGTATTTTTCAGCAAAATTTTTTGAC
TACTCAGCAAAGCAAACCAGACAGTGTTCATACCTCATTAAGCCATGTTC
AGAATGGAGAACCTTGTCCAACAGCTTTTGCAAAGGACAATGTTCATTGC
AAGCCTGTAAGTCCTTTAGGGGAAAATGGACTGACAAAAAGTGACTTTCC
AAGTTTAGCAAGTCAAAAAAAGATTGTTGATCCCACAGAAGGCAATCTGA
TAGTGTTACTTCGTGACTTCTACTATGGACAGCATATAGGAGATGGGCAG
CCAGAACCGAAGACTCACACAGCCTTTAAATGCCTCAGCTGCTTGAAAGT
TCTAAAAAATCTCAAGTTTATGAATCACATGAAGCACCATTTGGAACTTG
AGAGGCAGAGAGGTGACAGCTGGAAAAACCACACCACCTGCCAGCACTGC
CACCGCCAGTTTCCCACCCCATTCCAGCTGCAGTGTCACATTGAAAGTGT
CCACACTTCCCAGGAGCCCTCCACAGTCTGTAAAATCTGTGAATTGTCCT
TTGAGACAGATCAGGTTCTCTTACAGCACATGAAAGACAATCATAAGCCT
GGTGAAATGCCCTATGTATGCCAGGTTTGCAGTTACAGATCATCAGTCTT
TGCAGATGTGGATGCACATTTCAGAGCATACCATGGTAACACTAAGAATT
TACTTTGCCCCTTTTGTCTCAAAATTTTTAAAACTGCAACACCATACATG
TGTCATTATAGAGGGCACTGGGAAAAGAGTTTTCACCAGTGTTCCAAATG
TCGGCTACAGTTTTTAACTTTCAAAGAGAAAATGGAGCACAAGACCCAGT
GTCATCAAATGTTTAAGAAGCCTAAGCAGCTAGAAGGATTACCTCCTGAA
ACAAAAGTTGTTATTCAGGTATCACTGGAACCTCTTCAACCAGAATTGGT
GGAAGTAGCATCCATTACTGTGAACATATCTGATTCTGAACCATCACCCC
CCAAATCTAAAAGTAGGAGTTCAAAAAAACCCTGT



Protein Sequences

>BT19643-PA
MEPPCMLCEEDQEPEPQKSVGETKQVDDEDAELIFVGVEHVNEDADLIFV
GMTSNSKPVVSNILNRVTPGSCSRRKRYGHFRKDNAHKLQPVSHVTRTSE
AKIVLPVSDSESRSTDSPIIIEPLSKPDYKNISPQIVPNSFSELCSPLIT
FTSSLQHPVETTVSAGDMNKSPRVSKRLSTSETNSTNPKRPKLSDGIIGE
HSLALSPSGIFQQNFLTTQQSKPDSVHTSLSHVQNGEPCPTAFAKDNVHC
KPVSPLGENGLTKSDFPSLASQKKIVDPTEGNLIVLLRDFYYGQHIGDGQ
PEPKTHTAFKCLSCLKVLKNLKFMNHMKHHLELERQRGDSWKNHTTCQHC
HRQFPTPFQLQCHIESVHTSQEPSTVCKICELSFETDQVLLQHMKDNHKP
GEMPYVCQVCSYRSSVFADVDAHFRAYHGNTKNLLCPFCLKIFKTATPYM
CHYRGHWEKSFHQCSKCRLQFLTFKEKMEHKTQCHQMFKKPKQLEGLPPE
TKVVIQVSLEPLQPELVEVASITVNISDSEPSPPKSKSRSSKKPC




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.