BT19823

Link to gene wiki page

[-] General Information


Transcripts for BT19823 BT19823-RA  

NCBI Gene Symbol: LOC615026

Description:
similar to TRB@ protein

Overlapping Locus Information:

NCBI: 615026
Ensembl: ENSBTAG00000024245

Genomic Location: Chr4.102   1467719 .. 1471465    [-]

[-] Transcripts for BT19823

BT19823-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT19823-RA View Text HTML XML
Protein: BT19823-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: XM_866593.3
NCBI Protein: XP_871686.2

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT19823-RA
ATGAAGACCTTCATCTTTCTAGCTCTCCTGGGAGCTGCTGTTGCTTTCCC
TGTGGACGATGATGACAAGATCGTGGGCGGCTACACCTGTGGGGCAAATA
CTGTCCCCTACCAAGTGTCCCTGAACTCTGGCTACCACTTCTGCGGGGGC
TCCCTCATCAACAGCCAGTGGGTGGTGTCTGCGGCTCACTGCTACAAGTC
CGGAATCCAAGTGCGTCTGGGAGAAGACAACATTAATGTCGTTGAGGGCA
ATGAGCAATTCATCAGCGCATCCAAGAGCATCGTCCATCCCAGCTACAAC
TCAAACACCTTAAACAACGACATCATGCTGATTAAACTGAAATCAGCTGC
CAGTCTCAACAGCCGAGTAGCCTCTATCTCTCTGCCAACATCCTGTGCCT
CTGCTGGCACCCAGTGTCTCATCTCTGGCTGGGGCAACACCAAAAGCAGT
GGCACCAGCTACCCTGATGTCCTGAAGTGTCTGAAGGCTCCCATCCTATC
AGACAGCTCTTGCAAAAGTGCCTACCCAGGCCAGATCACCAGCAACATGT
TCTGTGCGGGCTACCTGGAGGGCGGAAAGGACTCCTGCCAGGGTGACTCC
GGTGGCCCTGTGGTCTGCAGTGGAAAGCTCCAGGGCATTGTCTCCTGGGG
CTCTGGCTGCGCTCAGAAAAACAAGCCTGGTGTCTACACCAAGGTCTGCA
ACTACGTGAGCTGGATTAAGCAGACCATCGCCTCCAAC



Protein Sequences

>BT19823-PA
MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGG
SLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYN
SNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSS
GTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDS
GGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.