BT21980

Link to gene wiki page

[-] General Information


Transcripts for BT21980 BT21980-RA  

NCBI Gene Symbol: CALHM1

Description:
calcium homeostasis modulator 1

Overlapping Locus Information:

NCBI: 532026

Genomic Location: ChrUn.1252   40799 .. 44274    [-]

[-] Transcripts for BT21980

BT21980-RA

Gene Model Source: RefSeq 

Sequences:

Transcript: BT21980-RA View Text HTML XML
Protein: BT21980-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: XM_610533.2
NCBI Protein: XP_610533.2
Ensembl Transcript: ENSBTAT00000009263
Ensembl Protein: ENSBTAP00000009263

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT21980-RA
ATGGACAAGTTCCGGATGATCTTCCAGTTCCTGCAGTCCAACCAGGAGTC
CTTCATGAATGGCATCTGCGGTATCATGGCCCTGGCCAGTGCCCAGATGT
ACTCTGCCTTCGACTTCAACTGCCCCTGCCTGCCGGGCTACAACGCTGCC
TACAGCGCCGGCATCCTGCTGGCGCCGCCCCTGGTGCTCTTCCTGCTCGG
CCTGGTCATGAACAACAACGTGTCCATGCTGGCCGAAGAATGGAAGCGGC
CTCAGGGCCACCGGGCCAAGGACCCCGCGGTGCTGCGCTACATGTTCTGC
TCCATGGCCCAGCGCGCCCTCATCGCGCCCGTCGTCTGGGTGGCTGTCAC
ACTGCTCGATGGCAAGTGCTTCCTTTGCGCATTCTGCACGGCGGTGCCCG
TGAGCCTGCTGGGCAATGGCAGCCTGGTGCCCGGCCTGCCCCCACCAGAG
CTTGCCCGCCTGCTGGCCCGGGTGCCCTGCCCTGAGATCTACGAGGGCGA
CTGGCTGCTGGCCCGCGAGGTGGCTGTGCGCTACCTGCGCTGCATCTCGC
AGGCCCTGGGCTGGTCCTTCGTGCTGCTGACCACGCTGCTGGCATTTGTC
GTGCGCTCTGTGCGGCCCTGCTTCACACAGGCCGCCTTCCTTAAAAGCAA
GTACTGGTCCCACTACATCGACATCGAGCGCAAGCTCTTTGATGAGACAT
GCACGGAGCACGCCAAGGCCTTCGCCAAGGTCTGTATCCAGCAGTTCTTC
GAGGCCATGAACCACGACCTGGAGCTGGGTCACGCCCACGGGGCGTTGGC
TGCCGGCCCCACTGGCTCGGCCGCCCCTGCTGCCACAGAAGGGGTGGATG
AGGAGAGGGAGAAGCTGCATGGCATCACCGATCAGGGCACCATGAACAGG
CTGCTCACGAGCTGGCATGAGTGCAAGCCGCCCCTGCGGCTGGGCCAGGA
GGAGCCACTGGTGGGCAACGGCTGGGCTGGGGGCGGGCCCCGGCCTTCAC
GCAAGGAGGTGGCCACCTACTTCAGCAAAGTG



Protein Sequences

>BT21980-PA
MDKFRMIFQFLQSNQESFMNGICGIMALASAQMYSAFDFNCPCLPGYNAA
YSAGILLAPPLVLFLLGLVMNNNVSMLAEEWKRPQGHRAKDPAVLRYMFC
SMAQRALIAPVVWVAVTLLDGKCFLCAFCTAVPVSLLGNGSLVPGLPPPE
LARLLARVPCPEIYEGDWLLAREVAVRYLRCISQALGWSFVLLTTLLAFV
VRSVRPCFTQAAFLKSKYWSHYIDIERKLFDETCTEHAKAFAKVCIQQFF
EAMNHDLELGHAHGALAAGPTGSAAPAATEGVDEEREKLHGITDQGTMNR
LLTSWHECKPPLRLGQEEPLVGNGWAGGGPRPSRKEVATYFSKV




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.