BT22347

Link to gene wiki page

[-] General Information


Transcripts for BT22347 BT22347-RA  

NCBI Gene Symbol: HDAC10

Description:
histone deacetylase 10

Overlapping Locus Information:

NCBI: 510654
Ensembl: ENSBTAG00000011000

Genomic Location: ChrUn.152   37424 .. 42317    [+]

GO Annotations for BT22347

Biological Process
GO:0000122 ISS  negative regulation of transcription from RNA polymerase II promoter
GO:0006355 IEA  regulation of transcription, DNA-dependent
GO:0016575 ISS  histone deacetylation
Molecular Function
GO:0004407 ISS  histone deacetylase activity
GO:0016566 IEA  specific transcriptional repressor activity
GO:0016787 IEA  hydrolase activity
GO:0042826 ISS  histone deacetylase binding
Cellular Component
GO:0000118 ISS  histone deacetylase complex
GO:0005634 IEA  nucleus
GO:0005654 ISS  nucleoplasm
GO:0005737 ISS  cytoplasm

[-] Transcripts for BT22347

BT22347-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT22347-RA View Text HTML XML
Protein: BT22347-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_001075460.1
NCBI Protein: NP_001068928.1
Ensembl Transcript: ENSBTAT00000014602
Ensembl Protein: ENSBTAP00000014602

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT22347-RA
ATGGGGACCGCACTTGTGTACCACGAGGACATGACCGCCACCCGGCTGCT
CTGGGACGACCCTGAGTGTGAGATCGAGTGTCCTGAGCGCCTGACCACTG
CCCTGGAGCGCCTGCAGCAGCATGGTCTGAAGCAAAGGTGTCTGCAGCTC
GTAGCCCGCGAGGCCTCAGAGGCGGAGCTGGGCCTGGTGCACAGCCCTGA
GTACGTAGCGCTGTTGCAGGGGACCCAGGCCTTGGGCACCAGGGAGCTCC
AGGCCCTGTCCAAGGAGTATGATGCCGTCTACCTCCATCCGAGTACCTTC
CACTGTGCCCGGCTGGCTGTGGGGGCCGCGCTGCAGCTGGTGGACGCGGT
GCTGACGGGAGCTGTGCGCAACGGGCTCGCCCTGGTGAGGCCTCCTGGGC
ACCACAGCCAGAGGGCTACTGCCAACGGATTCTGCGTGTTCAACAACGTA
GCCATAGCAGCCAAACACGCCCAGCAGAAACACGGGTTGCGCAGGATCCT
CATCGTTGACTGGGATGTCCATCATGGTCAGGGCATCCAGTATATCTTCG
AGGATGACCCCAGCGTCCTTTACTTCTCCTGGCACCGCTATGAGCACGGG
CACTTCTGGCCGTGTCTGCGGGAGTCAGACGCTGACGCTGTCGGGCGGGG
AAGGGGCCTCGGCTTCACTGTCAACCTGCCTTGGAACCAGGTCGGGATGG
GAAATGCTGACTACGTGGCTGCCTTCCTGCATGTGCTGCTGCCCCTGGCC
TTTGAGTTCGACCCTGAGCTGGTCCTAGTCTCCGCAGGATTCGACTCAGC
CATCGGTGATCCCGAGGGGCAGATGCTGGCCACACCGGAGTGCTTCGCCC
ACCTCACGCATCTGCTGCAGGTGCTGGCTGGCGGCCGGGTCTGCGCCGTG
CTGGAGGGTGGCTACCACCTGGAGTCCCTCTCCCAGTCTGTGTGCATGAT
GGTGCGAGCGCTGCTAGGCGACCCTGCCCTGCCCTTGTCAGGGCCCATGG
AGCCCCATGGCAGTGCCCTGGAATCCCTCCAGTGTGTGCGGGCAGCCCAG
GCCCCTCACTGGGTGAGCCTCCAGCAGCAAGGTGCCGCCCCTGTACTGAG
CCCCGGCACTCCCTGCCCAGAGGGGAGGCCCTCGCCGCTGCCGCTGGGGG
AGCCCCAATTCAAGGCAGTGGTGACCCAGGCTGCTGCTGCTCTGAGTTCA
CTCCTGGACCAGCTGCGCCTACACCCCACACCCCCTGTCCGCGTGGCTGT
TGCCCTGATTGCGCCAGACACAGGCCTGGCCCTGCCCCCGGGTGTCCTCT
GTGAGGAGGGGTCACTGCCGCAGGAGGAGACACAGGCCTGGGCCAGGCCA
CATGAGGCCCTGGCCCAGGACGGGGCCCTCACTGCACTTGGGAAGGTCCT
ATACCTCTTGGACAGGATCCTGGATGGGCAGGTGAGCAGTGGCATGGCAG
CCACCCCAGTCCCTGCTGCAGCTGCCACCCTGGACGTGGCTGTTCGGTAT
GGCCTGTCCCATGGAGCCCAGAGGCTGCTCTGTGTGGCTGTGGGACAGCT
GGATCGGCCCCCAGGTCTCACCGATGACGGGAGAAATCTATGGCTGAACA
TTGGCGGTGAGGAGGCAGCTGCCCCATCCATGTTCCACGTCTCTGTGCCA
CTGCCGGTGACAACTGGTGGGTTCCTGAGCTGTGCCCTGGCCCTGGTGCT
GCCCCTGGCCTACAGCTTCCAGCCTGACCTGGTGCTGGTGGCGCTGGGGC
CGGCCCATGGCTTGCGGGACCCCCAGGCTGCACTCCTGGCTGCACTGCTT
CGGGGCCCGGCAGGCGGCCGAGTCTTCGCCCTTGTGGATGAGGAATCCAC
ACCCCAGCTTGCAACAGTCCTGGCTAGGGTGCTGAATGGGGAGGCACCCC
CAAGCCTGGGCCCCTTCTCCATGGCCGCCCCAGAGGACACGCAAGCCCTG
ATGTACCTGAGAGGGCGACTGGAGCCAAGGTGGAAGATGCTGCAGGTGGC
TGCGCCTCAT



Protein Sequences

>BT22347-PA
MGTALVYHEDMTATRLLWDDPECEIECPERLTTALERLQQHGLKQRCLQL
VAREASEAELGLVHSPEYVALLQGTQALGTRELQALSKEYDAVYLHPSTF
HCARLAVGAALQLVDAVLTGAVRNGLALVRPPGHHSQRATANGFCVFNNV
AIAAKHAQQKHGLRRILIVDWDVHHGQGIQYIFEDDPSVLYFSWHRYEHG
HFWPCLRESDADAVGRGRGLGFTVNLPWNQVGMGNADYVAAFLHVLLPLA
FEFDPELVLVSAGFDSAIGDPEGQMLATPECFAHLTHLLQVLAGGRVCAV
LEGGYHLESLSQSVCMMVRALLGDPALPLSGPMEPHGSALESLQCVRAAQ
APHWVSLQQQGAAPVLSPGTPCPEGRPSPLPLGEPQFKAVVTQAAAALSS
LLDQLRLHPTPPVRVAVALIAPDTGLALPPGVLCEEGSLPQEETQAWARP
HEALAQDGALTALGKVLYLLDRILDGQVSSGMAATPVPAAAATLDVAVRY
GLSHGAQRLLCVAVGQLDRPPGLTDDGRNLWLNIGGEEAAAPSMFHVSVP
LPVTTGGFLSCALALVLPLAYSFQPDLVLVALGPAHGLRDPQAALLAALL
RGPAGGRVFALVDEESTPQLATVLARVLNGEAPPSLGPFSMAAPEDTQAL
MYLRGRLEPRWKMLQVAAPH




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.