BT22954

Link to gene wiki page

[-] General Information


Transcripts for BT22954 BT22954-RA  

NCBI Gene Symbol: TGM7

Description:
transglutaminase 7

Overlapping Locus Information:

NCBI: 538521

Genomic Location: Chr21.51   326598 .. 352772    [-]

GO Annotations for BT22954

Biological Process
GO:0018149 IEA  peptide cross-linking
Molecular Function
GO:0003810 IEA  protein-glutamine gamma-glutamyltransferase activity

[-] Transcripts for BT22954

BT22954-RA

Gene Model Source: RefSeq 

Sequences:

Transcript: BT22954-RA View Text HTML XML
Protein: BT22954-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: XM_580885.3
NCBI Protein: XP_580885.3

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT22954-RA
ATGGCAGCCTTGGAGCTCAGGTCCGTCGACCTGCAGAGCGCCAAGAACAA
CCAGGAGCATCACACACAGGAGATGGGCCTCCAGCGGCTCATCGTGCGCC
GTAGCCAGTCCTTCACCATCCAGCTGCATTTCAACCGCCCCTTCCACTCA
AAGAAGGACTCCATCACCTTTGTGGCTGAGACAGGACCAGCACCCAAGGA
GCTGCTGGGAACCCGAGCCACCTTCTTGCTCACCCAAGACCGACAAGGCA
AGGGCTGGAGTGCTTCTGACTTCACTGTTCATGCCAACTCGCTCGATGTC
TCCCTTTTCACACCACCCAGTGCAGTCATTGGTTCCTACTCTCTGAAGAT
GGAGATCTCTCAGGGCCCAAGTCATAGCACGACCCACCCTCTGGGGACCT
TCATCCTACTTTTTAACCCTTGGAGTGCAGAGGACGATGTCTACCTGCCA
AGTGAAACGCTGCTGCAGGAGTATATCATGATGGACTATGGCTTTGTTTA
CAAGGGTCATGAAAGATTCATCACCCCCTGGCCCTGGAACTACGGGCAGT
TTGAAGAGGACATCATAGATATCTGCTTTGAGATTCTGAACAAGAGCCTG
TACTTCTTAAAGAACCCGTCCAAAGACTACTCGCAGCGGAACGACGTGGT
GTACATCTGCAGGGTGGTGAGCGCCATGATCAACAGCAACGACGACAGCG
GCGTGCTGCAGGGGAACTGGGGAGAGGACTACTCCCGGGGGGTCAGCCCC
CTGGAGTGGACGGGCAGCGTGGCCATTCTGCGGCAGTGGGCGGCCAGGGG
CGGGCAGCCTGTGAAGTACGGGCAGTGCTGGGTCTTTGCAGCTGTGATGT
GTACGGTAATGAGATGCTTAGGTGTTCCAACACGTGTTGTTTCCAATTTC
CGTTCTGCACACAACTCGGATGCGAACTTGACCATTGACACCTACTATGA
CCAACATGCAGAGATGCTGCCAACTCAGAAACGAGACAAAATATGGAATT
TCCATGTCTGGAATGAGTGCTGGATGATCCGGAAAGATCTCCCTCCAGGA
TACAATGGGTGGCAGGTTCTGGACCCCACTCCCCAGCAAACCAGCAGCGG
GCTGTTTCGCTGTGGCCCTGCCTCCGTGAAGGCCATCAGGGAAGGGGAGG
TCCACCTGCCTTACGATACCCCATTTGTGTATGCCGAGGTGAACGCTGAT
GAAGTCGTTTGGCTACTGAAAGATGGCCAGGCCCAGGAAATCCTGGCCCA
TAACACCAGTTCCATCGGGAAGGAAATCAGCACCAAGATGGTAGGGTCAG
ACCAGCGCCAGAACATCACCAGCTCCTACAAGTACCCAGAAGGATCCCCT
GAGGAGCGATCTGTGTTTATGAAGGCCTCCCAGAAAATGCTGGGTGTGCG
GAGGACCTCTTCACCCTTCCTAGATCTGTTGGGGTCTGGGGGCGCTGTGG
GCCAGCCGGCACAGCTGCAGCTTCACCTGACCAGGAAGCCTGAGTGGGGC
CAGGACGTGCTGCTGAAGCTGCATGCCCGGAGGGTGGTGGACAGAGCCCA
CCCCCAGGGGCCCATCCACCTGGTGGTGGGTTTCTGTGCACAGACTCTGC
TGCACAATGGTGGTACCCGGCAGCCCCTCTGGAGACAAAAAGTGCACTTG
ACCCTGGACTTTGGGGAGGATATACAGTGGCCGCTCTCGCTACCTTACAA
CAATTACAGAAACAAGCTGACAGATGAAAAGCTGATCCGTGTGTCTGGCA
TTGCCAAAGTGGAGGAGACAGGGAGGTTCATGCTGGTTTTAAAAGATATC
TCCCTGGAGCCTCCCCACTTATCTATTGAGGTGTCTGAGAGGGCTGAGGT
GGGCAAGGCACTGAGAGTCCACATCTCGCTCACCAACACCCTCTCGGTGG
CTCTGAGTCACTGCACAATGGTGCTGGAAGGCAGTGGCCTCATCAATGGG
CAGATATCAAATGACCTTGGGACTCTGGTGGCCGGACACACTATCGAAAT
TGAAGTGGATCTCTACCCCATCAAAGCCGGACCCCGCCAGCTCCAAGTCC
TTGTCAGCAGCAACGAGATCAAAGAGATCAAGGGATACAAGGACATCTTT
GTTGCTGCAGCCAGGGCTCCT



Protein Sequences

>BT22954-PA
MAALELRSVDLQSAKNNQEHHTQEMGLQRLIVRRSQSFTIQLHFNRPFHS
KKDSITFVAETGPAPKELLGTRATFLLTQDRQGKGWSASDFTVHANSLDV
SLFTPPSAVIGSYSLKMEISQGPSHSTTHPLGTFILLFNPWSAEDDVYLP
SETLLQEYIMMDYGFVYKGHERFITPWPWNYGQFEEDIIDICFEILNKSL
YFLKNPSKDYSQRNDVVYICRVVSAMINSNDDSGVLQGNWGEDYSRGVSP
LEWTGSVAILRQWAARGGQPVKYGQCWVFAAVMCTVMRCLGVPTRVVSNF
RSAHNSDANLTIDTYYDQHAEMLPTQKRDKIWNFHVWNECWMIRKDLPPG
YNGWQVLDPTPQQTSSGLFRCGPASVKAIREGEVHLPYDTPFVYAEVNAD
EVVWLLKDGQAQEILAHNTSSIGKEISTKMVGSDQRQNITSSYKYPEGSP
EERSVFMKASQKMLGVRRTSSPFLDLLGSGGAVGQPAQLQLHLTRKPEWG
QDVLLKLHARRVVDRAHPQGPIHLVVGFCAQTLLHNGGTRQPLWRQKVHL
TLDFGEDIQWPLSLPYNNYRNKLTDEKLIRVSGIAKVEETGRFMLVLKDI
SLEPPHLSIEVSERAEVGKALRVHISLTNTLSVALSHCTMVLEGSGLING
QISNDLGTLVAGHTIEIEVDLYPIKAGPRQLQVLVSSNEIKEIKGYKDIF
VAAARAP




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.