BT23879

Link to gene wiki page

[-] General Information


Transcripts for BT23879 BT23879-RA  

NCBI Gene Symbol: HDAC6

Description:
histone deacetylase 6

Overlapping Locus Information:

NCBI: 513602
Ensembl: ENSBTAG00000013244

Genomic Location: ChrX.70   507577 .. 533151    [-]

[-] Transcripts for BT23879

BT23879-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT23879-RA View Text HTML XML
Protein: BT23879-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_001098960.1
NCBI Protein: NP_001092430.1
Ensembl Transcript: ENSBTAT00000017618
Ensembl Protein: ENSBTAP00000017618

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT23879-RA
ATGACCTCCACCGGTCAGGATTCCACCACACCCAAGGAGCGAAGGAGTAG
GCACAATCCCCACTCTCCCACCCACGACTCCAGCATCACCTCGAAGCGAG
GTGTTAAAAAGAGTGCCATACTCCGCTCCAGCCCCAGTCTAGCGGAGGTA
AAGAAGAAAGGCAGAATGAAGAAGCTTAGCCAAACAGCCGAGCAAGACCT
AATCATGGGGCTACAAGGGCTGAATCTGAACCTGGAGTCCAGGACACTGT
CTGGCACTGGCTTGGTGTTCGATGAACAGCTAAATGAATTCCACTGCCTC
TGGGATGACAGCTTCCCGGAACGCCCAGAGCGGCTCCATGCCATCAAGGA
GCAACTGATCCAGGAGGGCCTCCTGGACCGCTGCGTGTCCTTTCAGGCCC
GATTCGCTGAAAAGGAGGAGCTGATGTTGGTTCACAGCCTAGAATATATT
GATCTGATGGAAACGACCCAGTACATGAACGAGGAGGAGCTCCACGTCCT
AGCAGATACCTATGACTCAGTTTATCTGCATCCGAACTCATACACCTGTG
CCTGCCTGGCCTCAGGCTCTGTCCTCAGGCTGGTGGATGCAGTCCTGGAG
GCTGAGATCCGGAATGGCATGGCCATCATCAGGCCTCCTGGACACCACGC
CCAGCACAGTCTCATGGATGGATATTGCATGTTCAACCACGTGGCCGTGG
CTGCCCGTTACGCTCAACAGAAGCATGATATTCAGAGGGTCCTTATTGTG
GATTGGGATGTGCACCATGGTCAGGGAATACAGTTCGCCTTTGACCAAGA
TCCTAGTGTCCTCTATTTCTCCATCCACCGCTATGAGCAGGGTCGGTTCT
GGCCCCATCTTAAGGCCTCTAATTGGTCCACCACAGGTTTAGGCCAAGGC
CAGGGATACACCATCAATGTGCCTTGGAACCAGGTGGGGATGCAAGATGC
TGACTACATCGCCGCTTTCCTTCACGTCCTCCTGCCAGTCGCATTTGAGT
TCCAGCCCCAGCTGGTCCTGGTAGCTGCTGGATTTGATGCCCTCCAAGGG
GACCCCAAGGGTGAGATGGCCGCCACTCCAGCAGGGTTCGCCCAGCTCAC
CCATCTGCTCATGGGTCTGGCAGAAGGCAAGCTGATCCTCTCACTGGAGG
GTGGCTATAATCTCCACTCTCTGGCTGAAGGTGTCAGCGCCACCCTCCAC
ACCCTTCTGGGTGACCCTTGTCCTGTGTTAGAGTCTCCTGGTGCCCCCTG
CCCAAGTGCCCAGGCATCACTCTCCTGTACTCTGGAAGCCCTGGAACCCT
TCTGGGAGAGCCTTGTGAGATCAGTTGAGAGCCTGGAAGAAAAGGACACT
GTGGAGAAGGATGATGTGGAAGAGAAGGAGGAAGAGAGACTGCCACAGTC
CCCTGAGCTCTCCGTTCCGATATGGCCAGTGCTGCAGGCTCGCACGGGGT
TGGTCTATGACCAGCAGATGATGGACCACCACAACTTGTGGGATAACTAC
CACCCTGAGATGCCCCAGCGGATCCACTTTATCATGCATCACCTGGATGA
ACTGGGCCTTGGCAAGCGCTGCCACTCCCTACCCGCAAGGCCCGCTACAG
ATGCTGAGCTGCTCACCTGCCACAGTGCTGAGCACTTGGAACGTCTACGG
GCCACGGAGAAGATGAAGACCCGGGAGCTGCGCCGCGAGGGTGCCAACTA
TGACTCCATCTACATCTGCTCCAGCACTTTTGCCTGCGCACAGCTGGCTG
CAGGCGCCGCCTGTCGCCTGGTGGAGGCAGTACTGGCAGGAGAGGTTTTA
AATGGTGTTGCTGTAGTGCGACCTCCTGGCCACCATGCAGAGCCGGATGC
AGCTTGTGGTTTCTGTTTTTTTAATTCTGTGGCTGTGGCTGCTCGCCATG
CCCAGGCCATCAGTGGGCATGCTCTGCGGATCCTGATCGTGGACTGGGAC
ATCCATCATGGTAATGGAACTCAGCACATATTTGAGGAGGACCCCAGTGT
GCTGTACATTTCCCTGCACCGCTATGATCATGGTACCTTCTTTCCCATGG
GGAACGAGGGTGCCTGTACCCGGATAGGTAAAGCTACAGGCACAGGATTC
ACTGTCAATGTGGCCTGGAATGGACCCCGCATGGGTGATGCTGACTACCT
GGCTGCCTGGCACCGTCTGGTGCTTCCTGTTGCTTACGAGTTTAACCCAG
AACTCGTGCTGGTCTCAGCTGGCTTCGACGCTGCTCGGGGGGATCCTCTG
GGCGGCTGCCAGGTGTCGCCTGAGGGCTATGCCCACCTCACCCACCAGCT
GATGGGCTTGGCCAATGGCCATATCATCCTAATCCTAGAGGGTGGTTATA
ACCTGACGTCCATCTCAGAGTCCATGGCTGCCTGCACTCGCTCCCTTCTT
GGGGATCCACTGCCCCTGCTCACCCGGCTGCGGCCCCCACTATCTGGAGC
CCAGGCTTCTATCACTAAAACCATCCAAGTCCATCGAAGATACTGGCGCA
GTTTGCGGGTCATGAAGCGCAAAAACAAAGAGGAACTCTCCAGTTCTAAG
TTGATCACCAAGAAGCCATCCCAACCAGCCAGTCCTGGGTTAGCCAATGT
GACGACCACAGTGGAAGGGAACATCCTGGAGACAGGCATGGGACAGGCCG
CCTCAGAAGCATCTGTGAAAGAGTCCACTCCAGATCAGACTGAGTCAGCG
ACAGCTCCAGTAGAACTTACTCAGGGCCAGTCCTCAGACACAGCCACACA
AGGAGCTGCACTGGACCAGACCATCTCAGAGGGGGCCACAGGGGGAGCTG
AACTGATCCAAAACCCTCCAGCCTCATGCATCAACAACAGGATTCCTCCT
GCCTTACCCGTGCAAGGAGCCACAGCCCAGACATCCCCTAGTAAGCTGAT
GGCAAACCTCAGAATACTGGACCTAGATAGCACGACTCAGGAGCCCTCAG
AAGAGGAAGGACTACTAGGAGAGGCAGCTGGAGGTCAGGACACAAATGAG
TCAGTGCCAGTGCAGGTCTTTGGAGATCATGCTGACACTGACGAGGTCAT
GTTTTATGCCGTGAGACCACTGCTTTGGTGTCCTCATTTGGCGGCAGTAT
GCCCCATACCTGAGACAGGGCTGAATGTGACCCAACCTTGTCAGGACTGT
GGAACACTCCAGGAGAACTGGGTGTGTCTGTCTTGCTATCAGGTCTACTG
CGGTCGTTACATCAACGCTCATATGCTCCAGCACCATGAAGGTTCAGGAC
ACCCACTAGTACTCAGCTATGCCGACCTGTCTGCCTGGTGTTACCACTGT
CAGGCCTATGTCCACCACAAGGATCTCCTAGCAGTGAAGAACATCGCCCA
CCAGAACAAGTTTGGGGAAGACATACCCCATTCAGAC



Protein Sequences

>BT23879-PA
MTSTGQDSTTPKERRSRHNPHSPTHDSSITSKRGVKKSAILRSSPSLAEV
KKKGRMKKLSQTAEQDLIMGLQGLNLNLESRTLSGTGLVFDEQLNEFHCL
WDDSFPERPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYI
DLMETTQYMNEEELHVLADTYDSVYLHPNSYTCACLASGSVLRLVDAVLE
AEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHDIQRVLIV
DWDVHHGQGIQFAFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGLGQG
QGYTINVPWNQVGMQDADYIAAFLHVLLPVAFEFQPQLVLVAAGFDALQG
DPKGEMAATPAGFAQLTHLLMGLAEGKLILSLEGGYNLHSLAEGVSATLH
TLLGDPCPVLESPGAPCPSAQASLSCTLEALEPFWESLVRSVESLEEKDT
VEKDDVEEKEEERLPQSPELSVPIWPVLQARTGLVYDQQMMDHHNLWDNY
HPEMPQRIHFIMHHLDELGLGKRCHSLPARPATDAELLTCHSAEHLERLR
ATEKMKTRELRREGANYDSIYICSSTFACAQLAAGAACRLVEAVLAGEVL
NGVAVVRPPGHHAEPDAACGFCFFNSVAVAARHAQAISGHALRILIVDWD
IHHGNGTQHIFEEDPSVLYISLHRYDHGTFFPMGNEGACTRIGKATGTGF
TVNVAWNGPRMGDADYLAAWHRLVLPVAYEFNPELVLVSAGFDAARGDPL
GGCQVSPEGYAHLTHQLMGLANGHIILILEGGYNLTSISESMAACTRSLL
GDPLPLLTRLRPPLSGAQASITKTIQVHRRYWRSLRVMKRKNKEELSSSK
LITKKPSQPASPGLANVTTTVEGNILETGMGQAASEASVKESTPDQTESA
TAPVELTQGQSSDTATQGAALDQTISEGATGGAELIQNPPASCINNRIPP
ALPVQGATAQTSPSKLMANLRILDLDSTTQEPSEEEGLLGEAAGGQDTNE
SVPVQVFGDHADTDEVMFYAVRPLLWCPHLAAVCPIPETGLNVTQPCQDC
GTLQENWVCLSCYQVYCGRYINAHMLQHHEGSGHPLVLSYADLSAWCYHC
QAYVHHKDLLAVKNIAHQNKFGEDIPHSD




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.