BT24021

Link to gene wiki page

[-] General Information


Transcripts for BT24021 BT24021-RA  

NCBI Gene Symbol: COL4A4

Description:
collagen, type IV, alpha 4

Overlapping Locus Information:

NCBI: 407107

Genomic Location: Chr2.107   12752 .. 46088    [-]

GO Annotations for BT24021

Biological Process
GO:0007155 IEA  cell adhesion
Molecular Function
GO:0005201 IEA  extracellular matrix structural constituent
GO:0005515 IEA  protein binding
Cellular Component
GO:0005576 IEA  extracellular region
GO:0005581 IEA  collagen
GO:0005587 IEA  collagen type IV

[-] Transcripts for BT24021

BT24021-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT24021-RA View Text HTML XML
Protein: BT24021-PA View Text HTML XML

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT24021-RA
ATGGGCCCATCAGGCCCTCCAGGGCCTCCTGGGAGGCAAGGGAGTAAGGG
AGACTTGGGGCTCCCTGGGTGGCTTGGAGAAAAAGGTTCCCCAGGCCCTC
CTGGTGCCAAAGGATCTCCAGGGCCACCGGGAAAACCTGGTGCCTCAGGA
CTACCTGGCAGCAAAGGAGAAAAAGGTGACATGGTTGTATCAAGAGTGAA
AGGACACAAAGGAGAAAGAGGGCCTGATGGGCCCCCTGGACTTCCAGGGC
AGCAGGGACAACACGGTCGAGATGGATATGCTGGAGAAAAGGGGGACACA
GGGCCGCCTGGTGATCACGAGGATGCAGCCCCAGGTGATAAAGGGCCTCC
TGGACCGCCAGGGCCCCCTGGCAGAGCGGGACCTAGGGGGCCCCCAGGCC
TGGGATTTCCTGGCCCTCCAGGAGACAGAGGGCAACCAGGAGCTCCAGGC
TACCCAGGCAACAGGGGTCCTGATGGTCGGAAGGGTCGGAAAGGTGATAC
AATTCCTTGTAACGTAACATACCCTGGGAGGCCAGGCCCTCCAGGTTTTG
ATGGTCCTCCAGGTTTTCGTGGTGATATAGGAGAACCAGGTTTGGGAGGT
GAAAAGGGGTCCTCGCCTGTTGGGCCCCCAGGCACTCCAGGTTCACCTGG
AGTGAATGGTCAGAAAGGACCCCCAGGAGATCCTGCTATCGGCTACCCAG
GACTCCCGGGAAAGAGCGGTCTTCCAGGAGCACCAGGGTCCAAAGGACTC
AGAGGCGATGCCGGGCGTCCAGGGACCGCAGGGCCAGCTGGCATGCCCGG
ATTTCCGGGTCTCCAAGGTCCCAAAGGCCGAGAGGGAAATGCTGGGTTTC
CAGGGATCCCAGGCCCACCTGGTCACTCCTGTGAAAGAGGTGCTCCAGGG
ATACCAGGGCAACCGGGGCTCCCTGGGGCTCCAGGCAGTCCAGGACCCCA
GGGGCTGCCTGGCTTCCTGGGTTTTCCAGGAGAGAGAGGAAAACCTGGTC
AGGATGGACACCCTGGCAGAAAGGGAGAACATGGAGAGAAGGGTTGGCCT
GGCTTCCTGGGAGACCGAGGATTGAAAGGTGTCAAAGGTGATAAAGGTCA
TCCTGGGATGCAAGGAAGGAGAGGAGAGCCAGGAAGCCATGGACCACCTG
GATTTCACCCTGGGGAGCCCGGAAGAAATGGACAGCCAGGGCTTCCTGGA
CCCCCAGGCCCTCCAGGCTCACCTGGGCTGAGAGGAAACATTGGTTTTCC
AGGATTTCCGGGTGACCAGACTGGTAGTCCAGGGGGGCCTGGGCTGCAGG
GACCCCCAGGAGAAGTGGGGGATCCTGGACCAAGAGGCGTCCTGGGGGAC
CCAGGAGCACCAGGTCTTCCAGGAATAAAAGGCAGCACTGGCCTGGTCTC
C



Protein Sequences

>BT24021-PA
MGPSGPPGPPGRQGSKGDLGLPGWLGEKGSPGPPGAKGSPGPPGKPGASG
LPGSKGEKGDMVVSRVKGHKGERGPDGPPGLPGQQGQHGRDGYAGEKGDT
GPPGDHEDAAPGDKGPPGPPGPPGRAGPRGPPGLGFPGPPGDRGQPGAPG
YPGNRGPDGRKGRKGDTIPCNVTYPGRPGPPGFDGPPGFRGDIGEPGLGG
EKGSSPVGPPGTPGSPGVNGQKGPPGDPAIGYPGLPGKSGLPGAPGSKGL
RGDAGRPGTAGPAGMPGFPGLQGPKGREGNAGFPGIPGPPGHSCERGAPG
IPGQPGLPGAPGSPGPQGLPGFLGFPGERGKPGQDGHPGRKGEHGEKGWP
GFLGDRGLKGVKGDKGHPGMQGRRGEPGSHGPPGFHPGEPGRNGQPGLPG
PPGPPGSPGLRGNIGFPGFPGDQTGSPGGPGLQGPPGEVGDPGPRGVLGD
PGAPGLPGIKGSTGLVS




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.