BT24157

Link to gene wiki page

[-] General Information


Transcripts for BT24157 BT24157-RA  

NCBI Gene Symbol: F13A1

Description:
coagulation factor XIII, A1 polypeptide

Overlapping Locus Information:

NCBI: 617881

Genomic Location: Chr23.35   842660 .. 1011226    [+]

GO Annotations for BT24157

Biological Process
GO:0007596 IEA  blood coagulation
GO:0018149 IEA  peptide cross-linking
Molecular Function
GO:0003810 IEA  protein-glutamine gamma-glutamyltransferase activity
GO:0005509 IEA  calcium ion binding
GO:0008415 IEA  acyltransferase activity
GO:0016740 IEA  transferase activity
Cellular Component
GO:0005576 IEA  extracellular region
GO:0005737 IEA  cytoplasm

[-] Transcripts for BT24157

BT24157-RA

Gene Model Source: RefSeq 

Sequences:

Transcript: BT24157-RA View Text HTML XML
Protein: BT24157-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: XM_588122.4
NCBI Protein: XP_588122.3
Ensembl Transcript: ENSBTAT00000009559
Ensembl Protein: ENSBTAP00000009559

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT24157-RA
ATGTCGGAGTCCTCCGGGACCGCTTTCGGAGGCAGGAGAGCCATCCCCCC
CAACACCTCCAATGCAGCAGAGAACGACCCCCCCACTGTGGAGCTGCAGG
GCCTGGTGCCCCGGGGCTTCAACCCACAAGACTACCTTAATGTCACGAAT
GTTCACCTGTTCAAGGAGAGGTGGGATAGCAACAAAGTGGATCACCACAC
CGACAAATACAGCAACGACAAGCTGATCGTTCGTAGAGGACAGTCTTTCT
ACATTCAGATCGACTTCAATCGTCCCTATGACCCCACAAGGGATCTCTTC
AGGGTGGAGTATGTCATTGGTCTCTACCCCCAGGAGAATAAGGGAACCTA
CATTCCAGTCCCTTTGGTCTCTGAGCTGCAGAGTGGCAAGTGGGGGGCGA
AGGTGGTCATGAGAGAGGACAGGTCTGTCCGGCTGTCTGTCCAGTCTTCT
GCAGACTGCATTGTGGGGAAGTTCCGCATGTACGTGGCTGTCTGGACCCC
CTATGGGGTCATCCGCACCAGCCGAAACCCCGAAACGGACACATACATTC
TCTTCAACCCTTGGTGTGAAGAGGATGCTGTGTACCTGGAAAATGAAAAA
GAAAGAGAAGAGTGCGTCCTGAATGACATCGGGGTTATTTTTTATGGAGA
CTTCAACGACATCAAGAGCAGAAGCTGGAGCTACGGTCAGTTTGAGGATA
GCATCCTTGACGCTTGCCTGTTTGTGATGGACAAAGCGAATATGGACCTT
TCCGGCAGAGGGAATCCCATCAAAGTCAGCCGTGTTGGGTCTGCCATGAT
CAATGCCAAGGACGACGAAGGCGTCATTGCTGGCTCCTGGGACAATGTCT
ACGCTTATGGTGTTCCCCCATCAGCTTGGACCGGAAGTGTTGACATCCTC
CTAGAATACAAGAGTTCTCAGAAACCAGTCCGCTATGGTCAGTGCTGGGT
TTTTGCTGGTGTCTTTAATACATTTTTGCGATGCCTGGGGATACCAGCGC
GAGTCGTCACCAACTATTTCTCAGCCCATGACAATGATGCCAACTTGCAA
TTGGACATATTCTTGGAAGAAGACGGGAACGTGAACTCCAAACTCACCAA
GGATTCGGTGTGGAATTACCACTGCTGGAATGAAGCCTGGATGACGAGGC
CGGACCTTCCCGTTGGGTTTGGAGGTTGGCAAGTCGTGGACAGCACCCCC
CAGGAAAACAGCGATGGGATGTATCGGTGCGGCCCCGCCTCTGTTCAAGC
CATCAAGCACGGCCACGTCTGCTTCCAGTTTGACGCACCCTTCGTTTTTG
CAGAGGTCAACAGTGACCTTGTTTACGTCACAGCTAAGAAAGATGGCACT
CATGTGGTTGAAGCCCTTGATACCACCCACATTGGGAAATTAATCGTGAC
CAAAGAAATTGGAGGAGATGGCATGAAGGACATCACAGACACCTACAAAT
TCCAGGAAGGTCAAGAAGAAGAGAGGCTGGCCCTGGAAACCGCCATGATG
TATGGGGCCAAAAAGGCCCTCAACACAGAGGGCGTCCTCAAATCGAAGTC
TGATGTCCGCATGAACTTCGAGGTGGAGAACGCCGTGCTGGGCAGGGACT
TGAAGGTCATCATCACCTTCCGGAACAATGGCTCCGCCCGCTACACTGTC
ACAGCCTACCTCTCCGGAAACATCAGCTTCTACACCGGGGTCTCCAAGGC
GGAATTCAAGAACAAGACCTTCGAAGTGACCCTGGAGCCCTTGTCCTTTA
AGAGAGAGGAGGTGCTGATCGGAGCGGGCGAGTACATGGGCCAGCTGCTG
GAGCAGGCCTTCCTGCACTTCTTTGTCACGGCTCGAGTCAACGAGACCAG
GGACGTTCTGGCCAAGCAGAAGTCCATTGCGCTGACGGTCCCCAAGGTCG
TCATCAAGGTCCGTGGTGCTCAGGTCGTGGGTTCCGACATGGTGGTGACG
GTTGAGTTCACCAATCCTTTAAAAGAGACGCTTCGCAATGTCTGGATCCG
CCTGGATGGTCCTGGAGTGACGAAACCCTTGAGGAAGATGTTCCGGGAAA
TCCGGCCCAACTCCACCGTGCAGTGGGAAGAGCTGTGTCGGCCCTGGGTC
TCCGGCCCCCGGAAGCTGATCGCCAGCCTGACCAGCGACTCCCTGAGGCA
CGTGTACGGCGAGCTGGACTTGCAGATTCAGAGACGACCTTCGATG



Protein Sequences

>BT24157-PA
MSESSGTAFGGRRAIPPNTSNAAENDPPTVELQGLVPRGFNPQDYLNVTN
VHLFKERWDSNKVDHHTDKYSNDKLIVRRGQSFYIQIDFNRPYDPTRDLF
RVEYVIGLYPQENKGTYIPVPLVSELQSGKWGAKVVMREDRSVRLSVQSS
ADCIVGKFRMYVAVWTPYGVIRTSRNPETDTYILFNPWCEEDAVYLENEK
EREECVLNDIGVIFYGDFNDIKSRSWSYGQFEDSILDACLFVMDKANMDL
SGRGNPIKVSRVGSAMINAKDDEGVIAGSWDNVYAYGVPPSAWTGSVDIL
LEYKSSQKPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNDANLQ
LDIFLEEDGNVNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDSTP
QENSDGMYRCGPASVQAIKHGHVCFQFDAPFVFAEVNSDLVYVTAKKDGT
HVVEALDTTHIGKLIVTKEIGGDGMKDITDTYKFQEGQEEERLALETAMM
YGAKKALNTEGVLKSKSDVRMNFEVENAVLGRDLKVIITFRNNGSARYTV
TAYLSGNISFYTGVSKAEFKNKTFEVTLEPLSFKREEVLIGAGEYMGQLL
EQAFLHFFVTARVNETRDVLAKQKSIALTVPKVVIKVRGAQVVGSDMVVT
VEFTNPLKETLRNVWIRLDGPGVTKPLRKMFREIRPNSTVQWEELCRPWV
SGPRKLIASLTSDSLRHVYGELDLQIQRRPSM




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.