BT24293

Link to gene wiki page

[-] General Information


Transcripts for BT24293 BT24293-RA  

NCBI Gene Symbol: LOC509843

Description:
similar to histone deacetylase 7A

Overlapping Locus Information:

NCBI: 509843

Genomic Location: Chr5.43   676171 .. 700752    [+]

GO Annotations for BT24293

Biological Process
GO:0016568 IEA  chromatin modification
Molecular Function
GO:0004407 IEA  histone deacetylase activity
Cellular Component
GO:0000118 IEA  histone deacetylase complex

[-] Transcripts for BT24293

BT24293-RA

Gene Model Source: RefSeq 

Sequences:

Transcript: BT24293-RA View Text HTML XML
Protein: BT24293-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: XM_869350.3
NCBI Protein: XP_874443.3

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT24293-RA
ATGCCGGAGAGCCTGAAGATGAAGGCGGTGCTCGTCCAAGCGTCCTTAGG
GCAGTCTCACCAGCCTGCTGTCCGCCTCACCCCTCAGCCCTCTCCTTCCC
CTTCCAACTCTGGGAGCCTGCTTCGGCTGCCCAGAGAAGGCTGGGCACCT
CAGGGAAGCCTGACACTGCTGGATGGGACCCAGGTGAGCCCGGCTGCCCC
CTGCTCCAGCCCACCCATCATAGGCTGGCCCAGGCCCCGCGCAGACACGC
CAGGCCCTCAGCCCCAGCCCATGGACCTGCGGGTGGGCCAGCGGCCCCCG
GTGGAGCCCCCGCCGGAGCCCACACTGCTGGCCCTGCAGCACCCCCAGCG
CCTCCACCACCACCTCTTCTTGGCGGGCCTGCAGCCCCAGCGCTCGGCAG
AGCCCATGCGGCTCTCAATGGACACGCCGATGCCCGAGTTGCAGATGGGG
CAGCAGGAACAAGAGCTGCGGCAGCTTCTCAATAAGGACAAGAGCAAGCG
AAGTGCCGTAGCCAGCAGTGTGGTCAAGCAGAAGCTGGCAGAGGTGATTC
TGAAGAAACAACAGGCGGCCCTAGAGAGAACGGTTCATCCTAATAGCCCC
AGCGTTCCCTACAGAACTCTCGAGCCCTTGGAGACGGAGGGAGCTGCCCG
TTCCATGCTCAGCAGCTTCCTGCCTCCTGTTCCCAGCCTGCCTTGCGACC
CTCCAGAACACTTCCCTCTGCGCAAGACAGTCTCTGAGCCCAACCTGAAG
CTGCGCTACAAGCCCAAGAAGTCCCTGGAGCGGAGGAAGAACCCGCTACT
GCGGAAGGAGAGCGCCCCTCCCAGCCTCCGTCGGCGGCCAGCAGAGACCC
TCGGCGACTCCTCCCCTAGTAGTAGCAGCACGCCGGCATCAGGGTGCAGC
TCCCCCAACGACAGCGAGCATGGCCCCAACCCCGTCCTGGGCTCCGAGGC
GCTCTTGGGCCAGCGGCTGCGGCTGCAGGAGACCTCTCTGGCCCCGTTCG
CCTTGCTGCCCACAATCACACTGGGGCTGCCCGCCCCTGCCAGGGCTGAT
GGTGACCGCAGGACCCATGCGACTCTGGGCCCTCGGGGCCCAGTCCTGGG
GAACCCCCATGCTCACCTCTTCCTGCCCCATGGCCTGGAGCCCGAGGCTG
GGGGCCCCCTGCCCTCTCGCCTGCAGCCCATTCTCCTCCTGGATCCCTCA
GTGACTCACACCCCTCTGCTGACTGTGCCCGGGCTTGGGCCACTGCCCTT
CCACTTTGCCCAGTCCTTACTGACCACCGAGCGGCCCTCTGGATCAGGCC
TCCACCGGCCACTGAGCCGGACCCGCTCAGAGCCCCTGCCCCCAAGCGCC
ACTACCCCCTCACTGCTGGGGCCCCTGCAGCCCCGCCTGGAGCGGCTCAA
ACCTCACGTCCAGCTGATCAAGAGGTCAGCCAAGCCGAGTGAGAAGCCCC
GACTGCGGCAGATACCCTCAGCTGAGGACCTCGAGACGGATGGTGGGAGC
GTGGGGCCACTGCGGGATGATGGCCTGGAACATAGGGAGTCCAGCCATGG
GCAGCAGGAGGCCAGAGGCACTGTTCCTCTCCAGCAGCACCAGCAGGTGT
TCCTCTGGGAGCAGCAGCGACTGGCCGGGCGGCTCCCCCGAGGAGCCACT
GGAGACTCCGTGCTGCTTCCCCTGGCCCCGGGCAGTCACCGGCCCCTGTC
CAGGGCTCAGTCATCCCCGGCCGCACCTGCCTCGCTGTCGACCCCAGAGC
CCGCCAGCCAGGCCCGTATCCTGCCCAGCTCAGAGACCCCTGCCCGGACC
CTGCCCTTCACCACGGGGCTGGTCTATGACTCGGTGATGCTGAAGCACCA
GTGCTCCTGCGGGGACAACAGCAGGCACCCGGAGCACGCGGGCCGTATCC
AGAGCATCTGGTCCCGGCTGCTGGAACGGGGGCTCCGGAGCCAGTGTGAG
TCTCTCCGGGGCCGGAAGGCCTCCCTGGAGGAGCTGCAGTCAGTGCACTC
TGAGCGGCATGTACTCCTCTACGGCACCAACCCGCTCAGCCGCCTCAAAC
TGGACAATGGGAAGCTGGCAGGCCTCCTGGCACAGCGGATGTTCGTGATG
CTGCCTTGCGGCGGCGTTGGGGTGGACACCGACACCATCTGGAATGAGCT
GCACTCCTCCAACGCGGCCCGCTGGGCTGCTGGCAGCGTCACCGACCTCG
CCTTCAAAGTGGCCTCCCGTGAGCTAAAGAATGGTTTTGCTGTGGTTCGG
CCCCCAGGACACCATGCAGACCATTCCACAGCCATGGGCTTCTGCTTCTT
CAACTCAGTGGCCATTGCCTGCCGGCAGCTGCAACAGCAGGGCAAGGCCA
GCAAGATCCTCATTGTGGACTGGGACGTTCACCATGGCAACGGCACCCAG
CAGACCTTCTACCAGGACCCCAATGTGCTGTACATCTCCCTTCATCGCCA
TGACGACGGCAACTTCTTCCCTGGCAGTGGGGCTGTGGATGAGGTGGGAG
CTGGCAGCGGTGAGGGCTTCAATGTCAACGTGGCCTGGGCTGGAGGTCTC
GACCCCCCCATGGGGGATCCTGAGTACCTGGCTGCCTTCAGGATAGTCGT
GATGCCCATCGCCCGGGAGTTCTCTCCGGACCTGGTCCTGGTGTCAGCTG
GGTTTGATGCTGCCGAGGGTCACCCGCCCCCACTGGGTGGCTACCATGTT
TCTGCCAAGTGTTTTGGGTACATGACGCAGCAGCTCATGAGCTTGGCCGG
AGGTGCGGTGGTGCTGGCCCTGGAGGGTGGCCATGACCTCACAGCCATCT
GTGATGCCTCCGAGGCCTGTGTGGCTGCTCTTCTGGGCAACAAGGTGGAT
CCCCTCTCAGAAGAAGGCTGGAAGCAGAAACCCAACCTCAATGCCATCCG
CTCCCTGGAAGCTGTGATCCGAGTGCACAGTGAATACTGGGGCTGCATGC
AGCGCCTGGCCTCCCGTCCAGACTCCTGGGTGCACAGGGTGCCAGGGGCC
GATGCAGAAGAAGTAGAGGCAGTGACGGCGCTGGCATCCCTTTCCGTGGG
CATCCTGGCTGAAGAGCGAACCTCAGGGCAGCTGGTGGAGGAGGAGGAAC
CCATGAATCTC



Protein Sequences

>BT24293-PA
MPESLKMKAVLVQASLGQSHQPAVRLTPQPSPSPSNSGSLLRLPREGWAP
QGSLTLLDGTQVSPAAPCSSPPIIGWPRPRADTPGPQPQPMDLRVGQRPP
VEPPPEPTLLALQHPQRLHHHLFLAGLQPQRSAEPMRLSMDTPMPELQMG
QQEQELRQLLNKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPNSP
SVPYRTLEPLETEGAARSMLSSFLPPVPSLPCDPPEHFPLRKTVSEPNLK
LRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSSSSTPASGCS
SPNDSEHGPNPVLGSEALLGQRLRLQETSLAPFALLPTITLGLPAPARAD
GDRRTHATLGPRGPVLGNPHAHLFLPHGLEPEAGGPLPSRLQPILLLDPS
VTHTPLLTVPGLGPLPFHFAQSLLTTERPSGSGLHRPLSRTRSEPLPPSA
TTPSLLGPLQPRLERLKPHVQLIKRSAKPSEKPRLRQIPSAEDLETDGGS
VGPLRDDGLEHRESSHGQQEARGTVPLQQHQQVFLWEQQRLAGRLPRGAT
GDSVLLPLAPGSHRPLSRAQSSPAAPASLSTPEPASQARILPSSETPART
LPFTTGLVYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLLERGLRSQCE
SLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLAGLLAQRMFVM
LPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNGFAVVR
PPGHHADHSTAMGFCFFNSVAIACRQLQQQGKASKILIVDWDVHHGNGTQ
QTFYQDPNVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGL
DPPMGDPEYLAAFRIVVMPIAREFSPDLVLVSAGFDAAEGHPPPLGGYHV
SAKCFGYMTQQLMSLAGGAVVLALEGGHDLTAICDASEACVAALLGNKVD
PLSEEGWKQKPNLNAIRSLEAVIRVHSEYWGCMQRLASRPDSWVHRVPGA
DAEEVEAVTALASLSVGILAEERTSGQLVEEEEPMNL




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.