BT25768

Link to gene wiki page

[-] General Information


Transcripts for BT25768 BT25768-RA  

NCBI Gene Symbol: LCT

Description:
lactase

Overlapping Locus Information:

NCBI: 514332

Genomic Location: Chr2.63   1148555 .. 1196991    [+]

[-] Transcripts for BT25768

BT25768-RA

Gene Model Source: RefSeq 

Sequences:

Transcript: BT25768-RA View Text HTML XML
Protein: BT25768-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: XM_592166.3
NCBI Protein: XP_592166.3

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT25768-RA
ATGGAGCTGGCCTGGCATTTAGTCCTTACTGTTCTTTTAAGTTTTTCTTG
CTGGGGTTTAGACTGGGACTCTGATAAAAATTTCATCTCAGCTGCTGGTC
CTCTAACCAACAGCTTGCTACACGACCTGAGAGATCCCCTGGGAAACCAG
GCTTCTCCATTTGTAGCAGAAGATGAAGAAATTTACGTTTGTCGCCAGCC
ACTGCCTGCATTCCTGCCAGAGTACTTTAGAAGTGTCCGCGCCAGTATGA
TCACCCATTACAAAGTATTTCTGCCATGGGCACAACTTCTCCCAGAAGGA
ATCTCGGAGAACCCAGACAAGGAAACAGTGCTGTGCTATAGGCAACTGCT
TGAAGCCCTCAAGACTGCTCAGCTTCAGCCCTTGGTGGTTCTACACCACC
AGACCCTCCCTGCCAGCACTCTCCAGAGAACTGAGACCTTTGCCGATCTC
TTTGCGGCCTATGCCTCCTTTGCCTTCCACTCCTTTGGGGACCTAGTTGA
GATCTGGTTCACTTTTAGTGATTTGGAGAGAGTGATCACGAAGCTTCCCC
ACCAGGAATCAAGATCTTCACGTCTGCAGATGCTCACTGATGCCCACAGA
AAAGCCTATGAGATTTACCATGAAAAATATGCTTCTCAAGGTGGAAAACT
CTCTGTGGTCCTGCGAGCTGAGATGCTCTCCAAGCTCCTGCTAGAACCAT
CTATGTCTACACTTGTCAAGGATGCAGTTGACTTCATCTCTCTTGATTTA
TCTTATGAATGCCACAGTGAGGCAGATTTACCACAGACGTTGAGTGAACT
GCAGACCACTGAACCAAAAGTGAAAGTTTTCGTCTTCAGCCTGAAACTCC
AGAACTGCCTCTCCACCAGGAACAACGTAGCCCATCTGCTCTTCAGCCTG
CTCAAAGCCATAAATGAAGACCAAATGCTCGTCATTGGGTTTGATATTAG
TACATTCCTGAGCTGTTCATCGAGTTCCAAGAAAAGCTGGTCTTGTTCTC
TGAGTGACAGCCTGACCCTCCAGACTGCCCCGCAGCTGGGCCCAGACACA
GCAGTATACGCCTGGTCGCCCCGCTCAGCCTATCAGAGGGTCTGGGAAGC
GTTTGCCAACCAGTCCAAGGCAGAACGGGATGCTTTCCTGCAGGATGTTT
TTCCTGAAGGCTTCCTCTGGGGTGTCTCCACGGGAGCTTTTAACGTGGAA
GGAGGCTGGGCCGAGGATGGAAGAGGGCCGAGCATCTGGGACAGAGTTGG
GCACCAGAACACCAACAAGGGCCAAGCAACGCCAGAGGTGGCCAGCGACA
GTTACCACAAGGCAGACACTGACGTTGCCCTGCTCCGTGGCCTCCAGGCC
CAGGTCTACAAGTTCTCCATCTCCTGGTCCCGCATCTTCCCCACTGGGCA
GGGGCGTAACCCCAACCCCCGGGGTGTTGCCTACTACAACAAACTGATTG
ACAGCCTGCTGGACTCGCACATCGAGCCCATGGCCACCCTGTTCCACTGG
GACCTGCCCCAGGCCCTGCAGGATCGCGGTGGGTGGCAGAGTGAAGATGT
GGTGGACGCCTTCCTGGACTATGCAGCCTTCTGCTTCTCCACGTTTGGGG
ACCGTGTGAAGCTATGGGTGACCTTCCACGAGCCGTGGGTGATGAGCTAC
GCGGGCTACGGCACCGGCCAGCACGCACCGGGCATCTCCGACCCAGGGGT
GGCCTCTTTTAAGGTGGCCCACATGGTCCTCAAGGCGCACGCCAGGGCTT
GGCACCACTACAACAGCCACCACCGCCCACAGCAGCAGGGGCGTGTGGGC
ATCGTGCTGAACTCAGACTGGGCAGAACCCCTGTCCCCAGAGAGGCCTGA
GGACCTGAGAGCCGCCGAACGCTTCCTGCACTTCATGCTGGGCTGGTTTG
CACACCCCATCTTTGTGGATGGGGACTACCCGGCTGCCCTGAGGGCCCAG
ATTCAACAGATGAACAAGCAGTGCCCCAGTCCTGTGGCCCAGCTCCCTGA
GTTCACCGAGGCAGAGAAACAGCTCTTGAAAGGCTCTGCTGATTTTCTGG
GTCTGTCCCATTACACTTCCCGCCTCATCAGCAAGGCCCGAGGAGATACC
TGCATCCCCAGCTATGATACCATCGGAGGCTTCTCCCAGCATGTGGACCC
CACATGGCCCCAGACCGCATCCCCTTGGATTCGTGTGGTGCCCTGGGGCA
TAAGGAGGCTGTTGAACTTTGTATCCTTGGAATACACAAAAGGCAAAGTT
CCAATCTACCTAGCTGGGAACGGCATGCCCATAGGGGAGAGTGAAGACCT
CATCGATGATTCCCTGAGAGTCGACTATTTCAACCAGTATATCAATGAGG
TGCTCAAGGCTATCAAAGAAGACTCGGTGGTTGTTCAGTCTTACATCGCT
CGCTCCTTCATTGATGGCTTTGAAGGCCCTTCTGGGTATAGCCAGAGGTT
TGGGCTGTACCATGTCAACTTCGATGACAGCAGCAGGCCAAGGACTGCCA
GGAAATCTGCCTATTTTTTCACCAGCATGATCGAAAAAAATGGTTTCCTC
AACAAGGTAGTAAAAAGACAGTCACCACCCAGCATAGCAAACGTCCCCCG
GAAAATCAGAGCCTTCTCTTTTCCATCCGAGGTGCCCTCCAAGGCAAAAG
TGGTCTGGGAGAAGTTCTCCAACCAACCCAAGTTTGAGAGAGATCTGTTC
TACCACGGCACATTCCGCGATGACTTTCTGTGGGGCGTGTCCTCGTCAGC
CTATCAGATTGAAGGAGCTTGGGACGCTGACGGCAAAGGCCCCAGCATCT
GGGACAACTTTACCCACACACCAGGGAGCAACGTGAAAGACAATGCCACT
GGAGACGTGGCCTGTGACAGCTATAACCACCTGGATGCCGACCTGAACAT
GCTCCAAGCATTGAAGGTGAAGGCTTATCGCTTCTCCATCTCCTGGTCTC
GGATTTTCCCAACTGGGAGAAACACTTCTGTCAACGCACATGGTGTGGAT
TATTACAACAAGCTGATCAATGGCTTGGTGGAAAACAACATCTCTCCCAT
GGTGACCCTGTTCCACTGGGACCTGCCCCAGGCCCTGCAGGACATCGGAG
GCTGGGAGAATCCTTTACTGGTTGACTTGTTCAACAGCTATGCAGACTTC
TGCTTCCAGACCTTTGGTGACAGAGTCAAGTTCTGGATGACTTTTAATGA
GCCCACGTACCAGGCCTGGTTGGGATATGGCTCAGGGGAATTTCCCCCAA
ATGTGAATGACTCAGGCAGTGGACCTTACCGGATTGGCCATGCAATCATC
AAAGCTCATGCCAGAGTCTATCACACGTACGACGAGAAGTACAGGCAAGA
GCAGAAGGGGGTCATCTCCTTGAGCCTCAGTTCCCACTGGGCAGAGCCCC
AGTCGCTGGTCCCCAGGGACGTGGAGGCAGCTGACCGGATGCTGCAGTTC
TCCTTGGGTTGGTTTGCCCACCCCATCTTCCGAAACGGAGACTACCCCGA
TGCCATGAAGTGGAAGGTGGGGAACAGGAGTGAACTGCAGCACTTGGCCA
CCTCCCGCCTGCCCAGCTTCACGGAGGAGGAGAAGCAGTACATCGCAGCT
ACCGCCGACGTGTTCTGCCTCAACACTTACTCCTCCAGGATTGTGCAACA
CACGACACCCAGGTTAAACCCACCCTCCTACACAAGTGACCAGGAGCTGC
TGGAGTGGGAGGACACTTCCTGGCCTGCCACAGCCATGAACAGGGCTGCC
GCCTGGGGGATGCGGAGACTGCTCAACTGGATCAAGGAAGAGTATGGGGA
CATCCCCGTTTACATCACTGAGAACGGAGTGGGGCTGACAGACCCCAAAC
TGGAAGACACCGACAGGATATTTTACCACAAAACCTATATCAATGAAGCT
TTGAAAGCCTACAGACTTGATGGTGTCAACCTTCGAGGATATGCTGCCTG
GTCCCTGATGGACAACTTTGAGTGGCTGAATGGCTACACGGTCAAGTTTG
GACTGTACCATGTTGATTTTGATGACGTGAACAAGTCTCGCACAGCAAGA
GCCTCAGCCAGGTACTACACAGAGGTCATCACCAACAATGGCATGCCGCT
GTCCAAAGAGGATGAGTTCCTATACGGACAGTTCCCCAAGGACTTCATCT
GGAGTGCAGCTACCGCCTCATATCAGATCGAAGGTGCATGGAGAGCAGAC
GGCAAAGGACTCAGTATCTGGGACACGTTTTCTCACACACCCCTGAAGGT
TGAGAACAATGACACAGGAGACGTGGCCTGTGACAGTTACCACAAGATCG
CCGAGGACCTGGCCGCCCTGCAGACCCTGGGCGTGACCCACTATCGCTTT
TCCATCTCTTGGACTCGCATCCTCCCCGACGGGACCAACAAGTACGTCAA
CGAGGCGGGCCTGGACTACTACCTGCGGCTCATCGACACGCTGCTGGCCG
CCAACATCCAGCCCCAGGTGACTATTTACCACTGGGACCTGCCCCAGGCA
CTCCAGGATGTTGGGGGCTGGGAGAATGAGACAATTGTACAGCGGTTTAA
GGAGTATGCAGAGGTGCTGTTCCAGAGGCTAGGGGACAAGGTGAAGTTTT
GGATCACACTGAATGAGCCCTACGTCGTTGCTTACCAGGGCTACGGCTAC
GGGACGGCAGCTCCAGGGATCTCCTTTAGGCCCGGCACTGCCCCCTACAT
TGTTGGCCACAACCTGATAAAGGCTCACGCTGAGGCCTGGCATCTGTACA
ATGACGTGTACCGTGCCCGGCAAGGTGGCGTCATCTCCATCACCATCAGC
AGCGACTGGGCTGAGCCCAGAGACCCCTCCAACCAGGAGGATGTGGAGGC
AGCCAAGAGATACGTTCAGTTCATGGGAGGCTGGTTCGCACATCCGATAT
TCAAGAATGGGGATTACCCTGAGGTGATGAAGACGCGGATCCGTGACAGG
AGCTTAGCGGAAGGCCTCAACAAGTCTCGGCTCCCTGAGTTCACGGAGAG
TGAGAAGAGGAGGATCAACGGCACCTACGACTTTTTTGGGTTCAATCACT
ACACCACTGTCCTGGCCTACAATTTAAACTATGCCTCTTGGATCTCTTCC
TTCGATGCAGACAGGGGAGTGGCCTCCATCACAGACCGCTCCTGGCCAGA
CTCCGGCTCCTTCTGGCTGAAGATGACCCCTTTTGGCTTCAGGAGGATCC
TGAACTGGTTGAAGGAGGAATACAACAACCCCCCGATCTATGTCACAGAG
AACGGAGTCTCCCATCGGGGAGAAGCAAACCTCAATGACACTGCAAGGAT
CTACTACCTCCGCAGCTACATCAACGAGGCGCTCAAAGCTATGCAGGATA
AGGTGGACCTTCGAGGATACACGGTTTGGACTCTGATGGACAACTTCGAG
TGGGCCACCGGCTTCTCAGATAAGTTTGGTTTGCATTTTGTGAACTATAC
TGACCCTGCTCTGCCAAGGATCCCCAGAGAGTCAGCCAAGGTCTACGCCT
CCATAATCCGGTGCAGTGGCTTCCCCGACCCTGCTGCAGGGCCACATCCT
TGTCTTCAGCAAGAAGATGCTGAGCCCACCGCCAGCCCCGTGAGACAGAA
CATTCAGTTCCTGGGCCTCAGGCTGAGTACGACGGAAGCCCAGACAGCGC
TTAATGTGCTCTTTGCTTTCATGCTTCTTGGAGTCTGTTGTGTTGCACTT
CTGTCCTACAAGTATTTTAAGCGTTCCAAGCAAAAGCACACACAACCAGG
TGAACAGGAATTGAGCCACAGGTCTTCATTC



Protein Sequences

>BT25768-PA
MELAWHLVLTVLLSFSCWGLDWDSDKNFISAAGPLTNSLLHDLRDPLGNQ
ASPFVAEDEEIYVCRQPLPAFLPEYFRSVRASMITHYKVFLPWAQLLPEG
ISENPDKETVLCYRQLLEALKTAQLQPLVVLHHQTLPASTLQRTETFADL
FAAYASFAFHSFGDLVEIWFTFSDLERVITKLPHQESRSSRLQMLTDAHR
KAYEIYHEKYASQGGKLSVVLRAEMLSKLLLEPSMSTLVKDAVDFISLDL
SYECHSEADLPQTLSELQTTEPKVKVFVFSLKLQNCLSTRNNVAHLLFSL
LKAINEDQMLVIGFDISTFLSCSSSSKKSWSCSLSDSLTLQTAPQLGPDT
AVYAWSPRSAYQRVWEAFANQSKAERDAFLQDVFPEGFLWGVSTGAFNVE
GGWAEDGRGPSIWDRVGHQNTNKGQATPEVASDSYHKADTDVALLRGLQA
QVYKFSISWSRIFPTGQGRNPNPRGVAYYNKLIDSLLDSHIEPMATLFHW
DLPQALQDRGGWQSEDVVDAFLDYAAFCFSTFGDRVKLWVTFHEPWVMSY
AGYGTGQHAPGISDPGVASFKVAHMVLKAHARAWHHYNSHHRPQQQGRVG
IVLNSDWAEPLSPERPEDLRAAERFLHFMLGWFAHPIFVDGDYPAALRAQ
IQQMNKQCPSPVAQLPEFTEAEKQLLKGSADFLGLSHYTSRLISKARGDT
CIPSYDTIGGFSQHVDPTWPQTASPWIRVVPWGIRRLLNFVSLEYTKGKV
PIYLAGNGMPIGESEDLIDDSLRVDYFNQYINEVLKAIKEDSVVVQSYIA
RSFIDGFEGPSGYSQRFGLYHVNFDDSSRPRTARKSAYFFTSMIEKNGFL
NKVVKRQSPPSIANVPRKIRAFSFPSEVPSKAKVVWEKFSNQPKFERDLF
YHGTFRDDFLWGVSSSAYQIEGAWDADGKGPSIWDNFTHTPGSNVKDNAT
GDVACDSYNHLDADLNMLQALKVKAYRFSISWSRIFPTGRNTSVNAHGVD
YYNKLINGLVENNISPMVTLFHWDLPQALQDIGGWENPLLVDLFNSYADF
CFQTFGDRVKFWMTFNEPTYQAWLGYGSGEFPPNVNDSGSGPYRIGHAII
KAHARVYHTYDEKYRQEQKGVISLSLSSHWAEPQSLVPRDVEAADRMLQF
SLGWFAHPIFRNGDYPDAMKWKVGNRSELQHLATSRLPSFTEEEKQYIAA
TADVFCLNTYSSRIVQHTTPRLNPPSYTSDQELLEWEDTSWPATAMNRAA
AWGMRRLLNWIKEEYGDIPVYITENGVGLTDPKLEDTDRIFYHKTYINEA
LKAYRLDGVNLRGYAAWSLMDNFEWLNGYTVKFGLYHVDFDDVNKSRTAR
ASARYYTEVITNNGMPLSKEDEFLYGQFPKDFIWSAATASYQIEGAWRAD
GKGLSIWDTFSHTPLKVENNDTGDVACDSYHKIAEDLAALQTLGVTHYRF
SISWTRILPDGTNKYVNEAGLDYYLRLIDTLLAANIQPQVTIYHWDLPQA
LQDVGGWENETIVQRFKEYAEVLFQRLGDKVKFWITLNEPYVVAYQGYGY
GTAAPGISFRPGTAPYIVGHNLIKAHAEAWHLYNDVYRARQGGVISITIS
SDWAEPRDPSNQEDVEAAKRYVQFMGGWFAHPIFKNGDYPEVMKTRIRDR
SLAEGLNKSRLPEFTESEKRRINGTYDFFGFNHYTTVLAYNLNYASWISS
FDADRGVASITDRSWPDSGSFWLKMTPFGFRRILNWLKEEYNNPPIYVTE
NGVSHRGEANLNDTARIYYLRSYINEALKAMQDKVDLRGYTVWTLMDNFE
WATGFSDKFGLHFVNYTDPALPRIPRESAKVYASIIRCSGFPDPAAGPHP
CLQQEDAEPTASPVRQNIQFLGLRLSTTEAQTALNVLFAFMLLGVCCVAL
LSYKYFKRSKQKHTQPGEQELSHRSSF




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.