BT26846

Link to gene wiki page

[-] General Information


Transcripts for BT26846 BT26846-RA  

NCBI Gene Symbol: LOC614107

Description:
similar to Hexokinase-2 (Hexokinase type II) (HK II)

Overlapping Locus Information:

NCBI: 614107

Genomic Location: Chr11.6   2838394 .. 2853240    [+]

GO Annotations for BT26846

Biological Process
GO:0005975 IEA  carbohydrate metabolic process
GO:0006096 IEA  glycolysis
Molecular Function
GO:0004396 IEA  hexokinase activity
GO:0005524 IEA  ATP binding

[-] Transcripts for BT26846

BT26846-RA

Gene Model Source: RefSeq 

Sequences:

Transcript: BT26846-RA View Text HTML XML
Protein: BT26846-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: XM_865470.2
NCBI Protein: XP_870563.2

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT26846-RA
ATGCCTGCTCACACACTGTTTCTGATCCCCAGGGAGAAGGATGGCATCCA
GAAGGCCCGTGAGATCCTGGTGCGGCTGGGTCTGGACCCAACACATGAGG
ACTGTGTGGCCACTCATCGGGTCTGCCAGATCGTGTCCACACGCTCAGCC
AGCCTGTGCGCGGCCACGCTGGCAGCCGTGCTGTGGCGCATCAAGGAGAA
CAAAGGCGTGGACCGGCTGCGCTCCACTGTCGGGGTCGACGGCTCAGTCT
ACAAGAAGCACCCCCACTTTGCCAAGCGTCTTCACAAGACCGTGCGGCGC
CTCGTGCCTGACTGTGACGTCCGCTTCCTCCGCTCTGAGGATGGCAGTGG
CAAGGGGGCAGCCATGGTGACGGCAGTGGCCTATCGGCTGGCTGATCAGC
ACCGAGCCCGCCAGAAGACCCTGGAGTCTCTGAAGCTGAGCCGTGAGCAG
CTGCTGGAGGTCAAGAGGAGGATGAAGATAGAAATGGAGCGAGGTCTGAG
CAAGGAGACTCACGCCATTGCTCCTGTCAAGATGCTGCCCACCTACGTGT
GTGCCACCCCTGATGGCACAGAGAAAGGAGACTTCCTTGCCTTGGACCTT
GGGGGTACCAATTTCCGGGTCCTGCTGGTGCGTGTGAGGAATGGGAAGCG
ACGCGGGGTGGAGATGCACAACAAGATCTACTCTATCCCACAGGAGGTCA
TGCATGGCACAGGGGACGAGCTCTTCGACCACATCGTCCAGTGCATTGCA
GACTTCCTGGAGTACATGGGCATGAAGGGTGTGTCCCTGCCTCTAGGTTT
CACTTTCTCCTTCCCCTGCCAGCAGAACAGCCTGGACGAGAGCATCCTCC
TGAAGTGGACTAAAGGCTTCAAGGCGTCTGGCTGCGAGGGTGAGGACGTA
GTTATGCTGCTGAAGGAAGCCATCCACCGGCGAGAGGAGTTTGACCTGGA
TGTGGTTGCTGTGGTGAACGATACAGTTGGGACTATGATGACCTGTGGCT
ATGAAGACCCTCACTGTGAAGTCGGCCTCATTGTTGGCACAGGCAGCAAT
GCCTGCTACATGGAGGAGATGCGGAATGTTGAGCTGGTGGAAGGGGAAGA
GGGGCGGATGTGTGTCAACATGGAGTGGGGGGCCTTCGGGGACAACGGAT
GCCTCGATGACTTGCGCACAGAGTTTGATGCAGCTGTGGATGAACTTTCC
CTCAACCCTGGCAGACAGAGGTTTGAGAAAATGATCAGCGGCATGTACCT
GGGCGAGATTGTTCGTAACATCCTCATCGATTTCACCAAGCGTGGGCTGC
TCTTCCGTGGCCGCATCTCAGAGCGGCTCAAGACAAGGGGAATCTTTGAA
ACCAAGTTCCTGTCTCAGATTGAGAGTGACTGCCTGGCCCTGCTGCAGGT
CCGTGCCATCCTCCACCACTTAGGGCTCGAGAGCACGTGTGATGACAGCA
TCATCGTCAAGGAGGTGTGCACCGTGGTGGCTCGACGGGCAGCCCAGCTC
TGTGGTGCAGGCATGGCCGCTGTAGTGGACAAAATACGAGAAAACCGTGG
GCTGGACACCCTCAAAGTGACCGTGGGTGTGGACGGGACCCTCTACAAGC
TACATCCTCACTTTGCCAAAGTCATGCATGAGACGGTGAAGGACTTGGCT
CCAAAATGTGATGTATCCTTCCTGGAGTCAGAAGATGGCAGTGGGAAGGG
GGCAGCTCTCATCACTGCTGTGGCCTGCCGCATCCGAGAGGCTGGACAAC
GG



Protein Sequences

>BT26846-PA
MPAHTLFLIPREKDGIQKAREILVRLGLDPTHEDCVATHRVCQIVSTRSA
SLCAATLAAVLWRIKENKGVDRLRSTVGVDGSVYKKHPHFAKRLHKTVRR
LVPDCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLESLKLSREQ
LLEVKRRMKIEMERGLSKETHAIAPVKMLPTYVCATPDGTEKGDFLALDL
GGTNFRVLLVRVRNGKRRGVEMHNKIYSIPQEVMHGTGDELFDHIVQCIA
DFLEYMGMKGVSLPLGFTFSFPCQQNSLDESILLKWTKGFKASGCEGEDV
VMLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGYEDPHCEVGLIVGTGSN
ACYMEEMRNVELVEGEEGRMCVNMEWGAFGDNGCLDDLRTEFDAAVDELS
LNPGRQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRGIFE
TKFLSQIESDCLALLQVRAILHHLGLESTCDDSIIVKEVCTVVARRAAQL
CGAGMAAVVDKIRENRGLDTLKVTVGVDGTLYKLHPHFAKVMHETVKDLA
PKCDVSFLESEDGSGKGAALITAVACRIREAGQR




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.