BT27813

Link to gene wiki page

[-] General Information


Transcripts for BT27813 BT27813-RA  

NCBI Gene Symbol: PTGS1

Description:
prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)

Overlapping Locus Information:

NCBI: 282022
Ensembl: ENSBTAG00000006716

Genomic Location: Chr11.65   55149 .. 80104    [-]

GO Annotations for BT27813

Biological Process
GO:0001516 IEA  prostaglandin biosynthetic process
GO:0006633 IEA  fatty acid biosynthetic process
GO:0006979 IEA  response to oxidative stress
GO:0008217 IEA  regulation of blood pressure
GO:0042127 IEA  regulation of cell proliferation
GO:0055114 IEA  oxidation reduction
Molecular Function
GO:0004601 IEA  peroxidase activity
GO:0004666 IEA  prostaglandin-endoperoxide synthase activity
GO:0016491 IEA  oxidoreductase activity
GO:0016702 IEA  oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0020037 IEA  heme binding
GO:0046872 IEA  metal ion binding
Cellular Component
GO:0005737 IEA  cytoplasm
GO:0005783 IEA  endoplasmic reticulum
GO:0005792 IEA  microsome
GO:0005794 IEA  Golgi apparatus
GO:0005886 IEA  plasma membrane
GO:0019898 IEA  extrinsic to membrane

[-] Transcripts for BT27813

BT27813-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT27813-RA View Text HTML XML
Protein: BT27813-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: XM_864482.3
NCBI Protein: XP_869575.1

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT27813-RA
ATGAGCCGGCAGGGTATCTCGCTCCGATTCCCGCTGCTTCTCCTGCTGCT
GTCGCCGTCCCCCGTCTTGCCAGCGGACCCCGGGGCGCCCGCGCCAGTGA
ACCCCTGCTGTTACTATCCATGCCAGCACCAGGGGATCTGTGTTCGCTTC
GGCCTTGACCGCTACCAATGTGACTGCACCCGCACGGGCTATTATGGCCC
CAACTGCACCATCCCTGAGATATGGACCTGGCTCCGGACGACTTTGCGGC
CCAGCCCGTCTTTCGTCCACTTTCTGCTGACGCATGGGCGCTGGCTGTGG
GATTTTGTCAATGCCACCTTCATCCGGGACAAGCTCATGCGTCTGGTACT
CACAGTGCGTTCCAACCTTATCCCCAGCCCTCCCACCTACAACGTAGCGC
ATGACTACATCAGCTGGGAGTCCTTCTCCAATGTGAGTTATTATACTCGC
ATTCTGCCCTCCGTGCCCCGAGACTGTCCCACGCCCATGGGCACCAAAGG
GAAGAAGCAGTTGCCAGATGCGGAGTTTCTGAGTCGTCGCTTCCTGCTCA
GGAGGAAGTTCATCCCCGACCCTCAAGGCACCAACCTCATGTTTGCCTTC
TTTGCCCAACACTTCACCCATCAGTTCTTCAAAACTTCTGGCAAGATGGG
TCCTGGCTTCACCAAGGCGTTGGGCCACGGGGTAGACCTCGGCCACATTT
ATGGAGACAATCTGGAACGTCAGTATCAGCTGCGGCTCTTTAAGGATGGG
AAACTCAAGTACCAGATGCTCAATGGAGAGGTGTACCCGCCATCGGTGGA
AGAGGCTCCCGTGCTGATGCACTACCCCCGGGGCATCCCGCCCCAGAGCC
AGATGGCCGTGGGCCAGGAGGTGTTTGGGCTGCTTCCTGGGCTCATGGTC
TACGCCACGATATGGCTGCGTGAGCACAACCGCGTGTGTGACCTGCTGAA
GGCTGAGCACCCGACCTGGGGCGACGAGCAGCTCTTCCAGACGGCCCGCC
TCATCCTCATCGGGGAGACCATCAAGATTGTGATAGAGGAGTATGTGCAG
CAGCTGAGCGGCTACTTCCTGCAGCTCAAGTTCGACCCAGAGCTGCTGTT
TGGGGCCCAATTCCAGTACCGCAACCGCATCGCCATGGAGTTCAACCAGC
TTTACCACTGGCACCCGCTCATGCCCGACTCCTTCCGGGTGGGCCCCCAG
GACTACAGCTACGAGCAGTTTCTGTTCAACACCTCCATGCTGGTGGACTA
CGGGGTCGAGGCCCTGGTGGACGCCTTTTCTCGCCAGCCTGCAGGCCGGA
TCGGTGGGGGTAGGAACATAGACCACCACATCCTGCACGTGGCCGTGGAT
GTCATCAAGGAATCGCGGGAGCTGAGGCTGCAGCCTTTCAATGAGTACCG
CAAGAGGTTTGGCATGAAGCCCTACACCTCTTTCCAGGAGCTCACAGGGG
AGAAGGAGATGGCAGCTGAGTTGGAGGAGCTGTATGGAGACATCGATGCT
TTGGAATTCTACCCGGGGCTACTTCTTGAGAAGTGCCATCCGAACTCCAT
CTTTGGGGAGAGTATGATAGAAATGGGGGCTCCTTTTTCCCTTAAGGGCC
TCTTAGGGAACCCCATCTGTTCTCCAGAGTACTGGAAGGCAAGCACATTT
GGTGGTGATGTGGGCTTCAACCTTGTCAAGACGGCCACGCTGAAGAAGCT
GGTTTGCCTCAACACCAAGACTTGTCCCTACGTCTCCTTCCATGTGCCAG
ACCCCCATCGGGAGGACAGGCCTGGGGTGGAGCGGCCACCCACAGAGCTC



Protein Sequences

>BT27813-PA
MSRQGISLRFPLLLLLLSPSPVLPADPGAPAPVNPCCYYPCQHQGICVRF
GLDRYQCDCTRTGYYGPNCTIPEIWTWLRTTLRPSPSFVHFLLTHGRWLW
DFVNATFIRDKLMRLVLTVRSNLIPSPPTYNVAHDYISWESFSNVSYYTR
ILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDPQGTNLMFAF
FAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDG
KLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMV
YATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQ
QLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQ
DYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHILHVAVD
VIKESRELRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDA
LEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTF
GGDVGFNLVKTATLKKLVCLNTKTCPYVSFHVPDPHREDRPGVERPPTEL




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.