BT28421

Link to gene wiki page

[-] General Information


Transcripts for BT28421 BT28421-RA  

NCBI Gene Symbol: WHSC1L1

Description:
Wolf-Hirschhorn syndrome candidate 1-like 1

Overlapping Locus Information:

NCBI: 513054

Genomic Location: Chr27.23   305192 .. 333019    [-]

[-] Transcripts for BT28421

BT28421-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT28421-RA View Text HTML XML
Protein: BT28421-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_001075595.1
NCBI Protein: NP_001069063.1
Ensembl Transcript: ENSBTAT00000002006
Ensembl Protein: ENSBTAP00000002006

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT28421-RA
ATGGATTTCTCTTTCTCTTTCATGCAAGGGATCATGGGAAACACAATTCA
GCAACCACCTCAACTCATTGACTCCGCCAACATCCGCCAGGAGGATGCCT
TTGATAACAACAGTGACATTGTTGAAGATGGTGGCCAGACACCATATGAA
GCTACCTTGCAGCAAGGCTTTCAGTACCCACCCACAACAGAAGATCTTCC
TCCACTCACGAATGGCTACCCACCGTCCATCAGCATGTACGAAACTCAAA
CCAAATACCAGTCGTATAACCAGTATCCCAACGGGTCCGCCAACGGCTTT
GGTACAGTTAGAAACTTTAGCCCCAGTGACTATTACCATTCAGAAATTCC
AAACACACGACCCCATGAAATTCTGGAAAAGCCTTCTCCTCCACAGCCAC
CACCACCTCCTCCTTCGGTACCACAGACTGTGATTCCAAAGAAGACTGGC
TCACCTGAAATTAAACTAAAAATAACCAAAACTATCCAGAATGGCAGGGA
ATTGTTTGAGTCTTCCCTTTGTGGAGACCTTTTAAATGAAGTCCAGGCAA
GTGAGCACACAAAGTCAAAGCATGAAAGCAGAAAAGAAAAGAGGAAAAAG
AGCAACAAGCATGACTCATCTAGATCTGAAGAGCGCAAGTCACACAAAAT
CCCCAAATTAGAACCAGAAGAACAAAATAGACCAAATGAGAGGGTTGACC
CTGTATCAGAAAAACCAAGAGAAGACCCAGTGCTGAAAGAGGAGACCCCG
GTTCAGCCGATGCTACCTTCTGTTCCAACAGCAGAGGCGTCCGCTGGTGT
GAAGTTCCAGGTCGGCGATCTTGTTTGGTCTAAGGTGGGAACCTATCCTT
GGTGGCCTTGCATGGTGTCCAGTGACCCCCAACTTGAGGTGCACACCAAA
ATTAACACAAGAGGTGCCCGGGAGTATCACGTCCAGTTTTTTAGCAACCA
GCCAGAGAGGGCGTGGGTTCATGAGAAGCGGGTCCGAGAGTATAAAGGCC
ACAAACAGTATGAGGAACTACTGGCTGAAGCGACCAGACAAGCCAGCAAT
CACTCTGAAAAGCAGAAGATTCGGAAACCGCGGCCTCAGAGAGAACGTGC
CCAGTGGGACATCGGCATTGCCCACGCCGAGAAAGCGCTGACCATGACCC
GGGAGGAGAGGATAGAACAGTACACTTTCATCTATATTGATAAACAGCCC
GAGGAGACTTTATCCCAAGCAAAAAAGAACGTTGTCTCCAAAGCCGAAGT
GAAAAAGCCCCGAAGACCGAGGTCGGTGCTCAATGTGCAGCCAGAACAGA
CCAACGCCGGGGAGGCAGCCTCCTCGCCCTCAGGTACTGAAATGCGGAGA
CACAGCCAGCGGCGGCACACGGGCGTGGACGAGGACGAGCCCCCTCCCGT
GAAGGTGGCCTGGAAAACCGCGGCAGCGAGGAAATCCCTACCAGCATCCA
TCACCATGCACAAAGGGAGCCTGGACTTGCAGAAGTGTAACATGTCTCCC
GTGGTGAAAATTGAACAAGTGTTTGCTCTGCAGAATGCTACAGGAGATGG
GAAGTTTATCGATCAGTTTGTTTATTCGACGAAGGGAATTGGTAACAAAA
CAGAAATAAGTGTCAGGGGACAAGACAGACTTATAATTTCTACACCAAAC
CAGAGGAATGAAAAGGCAACTCAGAATATGTCGTCTCCTGAAGCAACATC
TGGTTCTGCAGGCTCAGTAGAAAAGAAGCAGCAGAGAAGATCAATTAGAA
CTCGTTCTGAATCGGAGAAATCCACTGAGGTTGTGCCAAAGAAGAAGATC
AAAAAGGAGCAGGTTGAAACAGTTCCTCAGGCTACAGTGAAGACTGGATT
ACAAAAAGGGTCGGCGGACCGGGGCGTGCAGGGCTCTGTCAGATTCAGTG
ACAGCTCCGTCTCCGCAGCGATTGAGGAAACTGTGGAC



Protein Sequences

>BT28421-PA
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDNNSDIVEDGGQTPYE
ATLQQGFQYPPTTEDLPPLTNGYPPSISMYETQTKYQSYNQYPNGSANGF
GTVRNFSPSDYYHSEIPNTRPHEILEKPSPPQPPPPPPSVPQTVIPKKTG
SPEIKLKITKTIQNGRELFESSLCGDLLNEVQASEHTKSKHESRKEKRKK
SNKHDSSRSEERKSHKIPKLEPEEQNRPNERVDPVSEKPREDPVLKEETP
VQPMLPSVPTAEASAGVKFQVGDLVWSKVGTYPWWPCMVSSDPQLEVHTK
INTRGAREYHVQFFSNQPERAWVHEKRVREYKGHKQYEELLAEATRQASN
HSEKQKIRKPRPQRERAQWDIGIAHAEKALTMTREERIEQYTFIYIDKQP
EETLSQAKKNVVSKAEVKKPRRPRSVLNVQPEQTNAGEAASSPSGTEMRR
HSQRRHTGVDEDEPPPVKVAWKTAAARKSLPASITMHKGSLDLQKCNMSP
VVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQDRLIISTPN
QRNEKATQNMSSPEATSGSAGSVEKKQQRRSIRTRSESEKSTEVVPKKKI
KKEQVETVPQATVKTGLQKGSADRGVQGSVRFSDSSVSAAIEETVD




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.