BT28422

Link to gene wiki page

[-] General Information


Transcripts for BT28422 BT28422-RA  

NCBI Gene Symbol: TK1

Description:
thymidine kinase 1, soluble

Overlapping Locus Information:

NCBI: 504652
Ensembl: ENSBTAG00000007121

Genomic Location: Chr19.30   1673643 .. 1686225    [+]

GO Annotations for BT28422

Biological Process
GO:0006260 IEA  DNA replication
Molecular Function
GO:0000166 IEA  nucleotide binding
GO:0004797 IEA  thymidine kinase activity
GO:0005524 IEA  ATP binding
GO:0016301 IEA  kinase activity
GO:0016740 IEA  transferase activity
Cellular Component
GO:0005737 IEA  cytoplasm

[-] Transcripts for BT28422

BT28422-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT28422-RA View Text HTML XML
Protein: BT28422-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_001097572.1
NCBI Protein: NP_001091041.1

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT28422-RA
ATGAGCTGCATCAACCTGCCCAACGTGCTGCCAGGCTCCCCCAGCAAGAC
CCGGGGGCAGATCCAGGTGATTCTCGGACCCATGTTCTCAGGAAAAAGTA
CTGAGCTGATGAGACGGGTCCGTCGCTTCCAGGTTGCCCAGTACAAGTGC
CTGGTGATCAAATATGCCAAAGACACGCGTTACAGCAGCCTCTTCTCCAC
ACATGACCGGAACACCATGGAGGCCCTGCCAGCCTGTCTGCTCCGGGACG
TGATCCAGGATGCGCAGAGGGTGGCTGTCATAGGCATCGACGAAGGGCAG
TTTTTCCCTGACATTGTGGAGTTCTGCGAGAACATGGCCAACTCGGGGAA
GACTGTCATTGTGGCTGCGCTGGATGGGACCTTTCAGAGGAAGGCTTTTG
GGACCATCTTGAACCTGGTGCCCCTGGCAGAGAGCGTGGTCAAGCTGACG
GCAGTGTGCATGGAGTGCTTCCGAGAGGCCGCCTACACCAAGAGGCTGGG
CGTGGAGAAGGAGGTCGAGGTCATCGGAGGAGCAGACAAGTACCACTCCG
TGTGCCGCCTATGCTACTTCAAGAAGGCCTCGGGTCAGCCCGCCGTGCTG
GACAGCGAAGAGAATAAGGAGAACTGCCCGATGACGCTGGGAAAGCCCGC
GGAGGCCCCAGGAGTCCGGAAGCTGTTTGCCACTCATCAGATCTGGCAGT
GCAGCCAGGCCAAC



Protein Sequences

>BT28422-PA
MSCINLPNVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQVAQYKC
LVIKYAKDTRYSSLFSTHDRNTMEALPACLLRDVIQDAQRVAVIGIDEGQ
FFPDIVEFCENMANSGKTVIVAALDGTFQRKAFGTILNLVPLAESVVKLT
AVCMECFREAAYTKRLGVEKEVEVIGGADKYHSVCRLCYFKKASGQPAVL
DSEENKENCPMTLGKPAEAPGVRKLFATHQIWQCSQAN




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.