BT28536

Link to gene wiki page

[-] General Information


Transcripts for BT28536 BT28536-RA  

NCBI Gene Symbol: TGM3

Description:
transglutaminase 3 (E polypeptide, protein-glutamine-gamma-glutamyltransferase)

Overlapping Locus Information:

NCBI: 505080
Ensembl: ENSBTAG00000001785

Genomic Location: Chr13.32   7495684 .. 7537708    [-]

[-] Transcripts for BT28536

BT28536-RA

Gene Model Source: GLEAN 

Sequences:

Transcript: BT28536-RA View Text HTML XML
Protein: BT28536-PA View Text HTML XML

Database Cross Reference

NCBI Transcript: NM_001101848.1
NCBI Protein: NP_001095318.1
Ensembl Transcript: ENSBTAT00000006432
Ensembl Protein: ENSBTAP00000006432

Coordinates:

[+]Transcript
[+]Exon
[+]Protein

[-] Sequences

Transcript Sequences

>BT28536-RA
ATGTCTGGACTCCAGAGTGTCGACTGGCAGATAGCCTCCAACCGGCAGGC
ACATCACACAGAGAGGTTCTATGGCAAGGATCTCCTGGTACGGAGAGGCC
AACTCTTCCAAGTGTCACTGACCTTATCCCAAGGTCTCAGCTCTGGAGGA
CGTGTGACATTCACAGCTTCCACAGGGCCTTACCCCTCAGAGTCGGCCAA
TACAAAGGCTGTGTTTCCACTCTCCAATGGGACAAGTAGCAGCGGCTGGG
GTGCACAACTTGTGTCCAGCAGGAACAATGTTCTGAACATCTCCATCCTT
AGTCCTGCAAATGCACCCATTGGAAGGTACACGCTAAACATGCAGATCTC
CTCCCAGGGCAGTGACTCCACGCTGAAACTTGGGACATTCATACTGCTCT
TTAACCCCTGGTTGCAAGCTGATAGTGTCTTTATGAGTAACCATGCTGCG
AGAGAGGAATATGTTCAGGAAGATGCTGGCATCATCTTTGTGGGAAGCAC
AAATCGAATTAGCATGATTGGCTGGAACTACGGACAGTTTGAAGAAGGCA
TCCTGAACATTTGCCTCTCAGTCCTGGATAACAGTCTGAATTTTCGCCGT
GACCCTGCTACGGATGTGGCCCACAGAAACGATCCCAAATATGTTGGCCG
GGTTCTCAGTGCAATGATCAATGGCAATGATGACAGTGGCGTGATTTCTG
GGAACTGGAGCGGTAGCTACACTGGTGGCCGGGATCCTAGGAACTGGAAT
GGCAGCGTGGAAATCCTCAAGGAGTGGCAAAGATCTGGCTTCAGGCCTGT
CCGATATGGCCAGTGCTGGGTCTTTGCTGGAACCCTCAACACAGTGTTGC
GATGTTTGGGGATTCCCTCCCGAGTGATCACCAACTTCAACTCAGCTCAT
GACACAGACCAAAACCTCAGTGTGGATGTCTACTACGACCCCTTGGGACG
GCCCATGGACAAAGGCAGTGATAGTGTGTGGAATTTCCACGTCTGGAATG
AAGCCTGGTTTGTGCGGTCTGACCTGGGCCCTTCGTACAATGGATGGCAG
GTTCTGGACGCCACCCCTCAGGAGAGAAGCCAAGGGGTGTTCCAGTGCGG
CCCTGCTTCGGTGATCGCTATCCGAGAGGGTAATGTGGACTGGGACTTCG
ACATGCCCTTCATCTTTGCGGAGGTCAATGCCGACCGCATCACATGGATC
TACGAGTCGAACGGTGCCTTGAAGAAGAATTCCGCAGACACTCACAGCGT
CGGCAAGCACATCAGTACCAAGGCGGTGGGCAGCAACTCTCGCATGGATG
TCACCGAAAAGTACAAGTATCCAGAAGGTTCCAGCCAGGAAAGACAAGTA
TTTGAAAAGGCTTTGAGGAAACTTAAACCCACAATGTCATTTAGTGCAAC
ATCTGCAAGCAGCCTGGCAAGAGAGGAACAGGAGCCTAGCATCTCTGGGA
GGTTCAAGGTCGCTGGTGTACTGACAGTGGGCAAAGAAGTCAACCTGATC
CTAATGCTCAAAAACCTAACAAGTGATACAAAGACAGTGACAGTGAATAT
GACAGCCTGGACCATCGTCTACAACGGCACACTTGTACACGAGGTGTGGA
AGGACTCTGTCACTAAATCCCTGAATCCCGAAGAAGAAATAGAGCACCCT
GTAAAGATCGCATATGCTCAGTATGAGAAGTACCTGAAGGCGGACAACAT
GATCCGGACCACAGCCGTGTGCCAGGTCACCGATGAGCCTGAGGTGGTGG
TGGAGAGGGACATCATCCTGGACAACCCCACCTTGACCCTTGAGGTGCTG
GATGAGGCCCGGGTGCAGAAGCCTGTGAACGTGCAGATGCTCTTTTCCAA
CCCACTGGATGAGCCCGTGAAGGACTGCGTGCTGATGGTGGAGGGCAGCG
GCCTGCTGCTGGGCAATCTCAAGATCGACGTGCCAGCCCTGCGTCCCAAA
GAGCGGTCCCGCGTGCGTTTTGAGATCCTGCCCACCCGGAGTGGCACCAA
GCAGCTCCTTGCCAACTTCTCCTGCAACAAGTTCCCCGCAATCAAGGCCA
TGCTGTCCGTTGATGTGGCTGAG



Protein Sequences

>BT28536-PA
MSGLQSVDWQIASNRQAHHTERFYGKDLLVRRGQLFQVSLTLSQGLSSGG
RVTFTASTGPYPSESANTKAVFPLSNGTSSSGWGAQLVSSRNNVLNISIL
SPANAPIGRYTLNMQISSQGSDSTLKLGTFILLFNPWLQADSVFMSNHAA
REEYVQEDAGIIFVGSTNRISMIGWNYGQFEEGILNICLSVLDNSLNFRR
DPATDVAHRNDPKYVGRVLSAMINGNDDSGVISGNWSGSYTGGRDPRNWN
GSVEILKEWQRSGFRPVRYGQCWVFAGTLNTVLRCLGIPSRVITNFNSAH
DTDQNLSVDVYYDPLGRPMDKGSDSVWNFHVWNEAWFVRSDLGPSYNGWQ
VLDATPQERSQGVFQCGPASVIAIREGNVDWDFDMPFIFAEVNADRITWI
YESNGALKKNSADTHSVGKHISTKAVGSNSRMDVTEKYKYPEGSSQERQV
FEKALRKLKPTMSFSATSASSLAREEQEPSISGRFKVAGVLTVGKEVNLI
LMLKNLTSDTKTVTVNMTAWTIVYNGTLVHEVWKDSVTKSLNPEEEIEHP
VKIAYAQYEKYLKADNMIRTTAVCQVTDEPEVVVERDIILDNPTLTLEVL
DEARVQKPVNVQMLFSNPLDEPVKDCVLMVEGSGLLLGNLKIDVPALRPK
ERSRVRFEILPTRSGTKQLLANFSCNKFPAIKAMLSVDVAE




*The scaffold Min and Max coordinates indicate the minimum and maximum range of the gene on the scaffold, and not the start and end coordinates of the gene.